SitesBLAST
Comparing HSERO_RS21145 FitnessBrowser__HerbieS:HSERO_RS21145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 76% coverage: 2:332/437 of query aligns to 66:396/534 of P53322
- K283 (≠ D222) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8u3hA Structure of fmoc-leu-oh bound sialin
23% identity, 89% coverage: 37:425/437 of query aligns to 15:409/425 of 8u3hA
8u3gA Structure of naag-bound sialin
23% identity, 89% coverage: 37:425/437 of query aligns to 15:411/427 of 8u3gA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
24% identity, 89% coverage: 33:421/437 of query aligns to 21:414/430 of P0AA76
- Y29 (= Y41) binding
- D31 (= D43) mutation to N: Loss of galactonate transport activity.
- R32 (= R44) binding
- Y64 (= Y76) binding
- E118 (= E130) mutation to Q: Loss of galactonate transport activity.
- W358 (= W365) binding
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
22% identity, 81% coverage: 70:425/437 of query aligns to 113:472/495 of Q9NRA2
- K136 (≠ R93) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I138) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ VI 153:154) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LQ 228:229) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ADIDG 230:234) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G291) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P297) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (= G332) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
23% identity, 89% coverage: 33:421/437 of query aligns to 10:395/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 89% coverage: 33:421/437 of query aligns to 13:379/393 of 6e9oA
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
24% identity, 78% coverage: 70:411/437 of query aligns to 113:434/495 of Q8BN82
- H183 (≠ I138) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 67% coverage: 121:411/437 of query aligns to 166:434/495 of Q5Q0U0
- R168 (= R123) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L126) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G127) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E130) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A131) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ Y134) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P135) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I138) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ L141) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ ADIDG 230:234) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P297) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (= G332) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 136 K→E: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 51% coverage: 61:285/437 of query aligns to 84:285/444 of Q8NLB7
- R103 (≠ K89) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
21% identity, 79% coverage: 24:370/437 of query aligns to 93:447/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
22% identity, 81% coverage: 5:358/437 of query aligns to 6:360/448 of Q51955
- D41 (= D43) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (≠ N46) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (≠ N84) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (≠ H88) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G91) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R123) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ Y143) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ Q189) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D313) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (= H321) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
Sites not aligning to the query:
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 93% coverage: 20:425/437 of query aligns to 66:491/582 of Q9JI12
- R88 (= R44) mutation to A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- H128 (≠ A69) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R123) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E130) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (vs. gap) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
21% identity, 94% coverage: 15:425/437 of query aligns to 3:433/452 of 7t3nA
- binding (1s,3r)-1-aminocyclopentane-1,3-dicarboxylic acid: Y77 (= Y76), Y137 (= Y134), Y165 (≠ P162), R264 (≠ M266), F268 (vs. gap), Y269 (= Y269)
- binding (2R)-2-(methoxymethyl)-4-{[(25R)-spirost-5-en-3beta-yl]oxy}butyl 4-O-alpha-D-glucopyranosyl-beta-D-glucopyranoside: R12 (≠ K24), Y13 (≠ V25), E152 (≠ R149), G163 (= G160)
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
23% identity, 81% coverage: 72:423/437 of query aligns to 90:448/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
27% identity, 44% coverage: 50:243/437 of query aligns to 29:219/446 of A0A0H2VG78
- R102 (= R123) mutation to A: Loss of transport activity.
- I105 (≠ L126) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (≠ Y143) mutation to A: Loss of transport activity.
- Q137 (≠ M158) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 250 Q→A: Loss of transport activity.
- 251 Q→A: Loss of transport activity.
- 256 N→A: Loss of transport activity.
- 357 W→A: Loss of transport activity.
Query Sequence
>HSERO_RS21145 FitnessBrowser__HerbieS:HSERO_RS21145
MTTASTTGVGLDVNDKSKDGLYKKVFWRIMPFLMLCYVIAYLDRVNVGFAKLQMSQDLGF
SETVFGLGAGLFFIGYFLFEVPSNILMHKVGARIWIARIMITWGILSAAFMFVQNATQFY
ILRFLLGLAEAGFYPGIILYLTYWFPSHRRAKVIAVFMSGIPVAGILGNPLSGWIMDAFH
QNGGLEGWQWMFLIEAIPAVLIGVATVLYLDNDVKSAKWLNDEEKASLQADIDGDAKGKE
SKHGFGAIVKDARVWLMCLIYFSFVMGQYGLTLWMPTLVKATGVKGNLEIGLLSAIPFGC
AIIAMNLIGRSADRMRERRWHLVIPALMGGVGFVGAALFADNTAVSIASLSLAAAGVLTC
APLFWSLPTAFLSGAAAAVGIAAINSVGNLAGFVSPYLIGYLKDLTHNNATGMYMLAVML
VVGSIATLATKPGMVNK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory