SitesBLAST
Comparing HSERO_RS21150 FitnessBrowser__HerbieS:HSERO_RS21150 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
6voqA Crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae
47% identity, 88% coverage: 7:195/215 of query aligns to 4:193/207 of 6voqA
Q58813 L-fuculose phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
33% identity, 84% coverage: 11:191/215 of query aligns to 3:175/181 of Q58813
- N25 (= N33) mutation to L: It shows a 3-fold increase of the affinty for dihydroxyacetone phosphate (DHAP) and a 3-fold decrease of the affinity for DL-glyceraldehyde compared to the wild-type.; mutation to T: It shows a 5-fold decrease of the affinty for dihydroxyacetone phosphate (DHAP), but has the same affinity for DL-glyceraldehyde compared to the wild-type.
4fuaA L-fuculose-1-phosphate aldolase complex with pgh (see paper)
30% identity, 88% coverage: 1:189/215 of query aligns to 1:181/206 of 4fuaA
- active site: E73 (≠ T77), H92 (= H96), H94 (= H98), Y113 (= Y123), A117 (≠ K127), H155 (≠ L163)
- binding phosphoglycolohydroxamic acid: G28 (= G32), N29 (= N33), T43 (= T47), S71 (= S75), S72 (≠ K76), E73 (≠ T77), H92 (= H96), H94 (= H98), H155 (≠ L163)
- binding zinc ion: H92 (= H96), H94 (= H98), H155 (≠ L163)
P0AB87 L-fuculose phosphate aldolase; D-ribulose-phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 88% coverage: 1:189/215 of query aligns to 1:181/215 of P0AB87
- T26 (≠ S30) mutation to A: Decrease of the aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
- A27 (= A31) mutation Missing: Strong decrease of the aldolase activity.
- GN 28:29 (= GN 32:33) binding
- N29 (= N33) mutation to L: Loss of aldolase activity; when associated with A-71.; mutation to Q: Strong decrease of the aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
- TG 43:44 (≠ TD 47:48) binding
- S71 (= S75) mutation to A: Loss of aldolase activity; when associated with L-29.; mutation to Q: Loss of aldolase activity.
- SS 71:72 (≠ SK 75:76) binding
- E73 (≠ T77) active site, Proton donor/acceptor; binding ; mutation to Q: Loss of aldolase activity; when associated with F-113 and F-209.; mutation to S: Loss of aldolase activity.
- H92 (= H96) binding
- H94 (= H98) binding
- Y113 (= Y123) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to F: Slowly inactivated. Has a preference for the D-aldehyde and shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with Q-73 and F-209.
- F131 (≠ P139) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to A: Has a slight preference for the D-aldehyde and shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with W-206.
- H155 (≠ L163) binding
Sites not aligning to the query:
- 206 F→W: Decrease of aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P). Loss of aldolase activity; when associated with A-131.
- 207:215 mutation Missing: Loss of aldolase activity. Has a slight preference for the D-aldehyde.
- 209 Plays a key role in the stabilization of the transition state and positioning the aldehyde component; Y→F: Slowly inactivated and unable to discriminate between the enantiomers. Shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with Q-73 and F-113.
- 211:215 mutation Missing: Decrease of aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
2fuaA L-fuculose 1-phosphate aldolase crystal form t with cobalt (see paper)
30% identity, 88% coverage: 1:189/215 of query aligns to 1:181/210 of 2fuaA
Sites not aligning to the query:
1dzuP L-fuculose-1-phosphate aldolase from escherichia coli mutant t26a (see paper)
30% identity, 88% coverage: 1:189/215 of query aligns to 1:181/209 of 1dzuP
7x78A L-fuculose 1-phosphate aldolase (see paper)
31% identity, 82% coverage: 30:206/215 of query aligns to 23:193/203 of 7x78A
Sites not aligning to the query:
P0DTQ0 5-deoxy-D-ribulose 1-phosphate aldolase; 5-deoxyribose disposal aldolase; EC 4.1.2.- from Bacillus thuringiensis serovar kurstaki (strain ATCC 35866 / NRRL B-4488 / HD73) (see paper)
28% identity, 94% coverage: 11:213/215 of query aligns to 7:209/213 of P0DTQ0
- E76 (≠ T77) binding
- H95 (= H96) binding
- H97 (= H98) binding
- H157 (≠ L163) binding
6btgA Crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis (see paper)
28% identity, 93% coverage: 11:211/215 of query aligns to 7:207/207 of 6btgA
4c25A L-fuculose 1-phosphate aldolase (see paper)
25% identity, 95% coverage: 8:212/215 of query aligns to 7:211/212 of 4c25A
Query Sequence
>HSERO_RS21150 FitnessBrowser__HerbieS:HSERO_RS21150
MSRNTNESALREEICRIGASLYQRGYTVGSAGNISARLEDGWLITPTDACLGFLDPAAIA
KVNAAGEWVSGDKPSKTLVLHRAIYDNNPEMHAVVHTHSTHLVSLTINGVYSEQDVLPPI
TPYYVMKVGHIPLIRYARPGAPEVAEQVAKIATQVRGVLLERLGPVVWESSVSKAAFALE
ELEETAKLWHLAGGRATPLEEPALEDLRATFKARW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory