Comparing HSERO_RS21250 HSERO_RS21250 amino acid ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
53% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
53% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
53% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
53% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
56% identity, 97% coverage: 2:238/244 of query aligns to 1:236/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
53% identity, 97% coverage: 3:238/244 of query aligns to 1:236/240 of 4ymuJ
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
53% identity, 95% coverage: 8:238/244 of query aligns to 11:253/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
53% identity, 95% coverage: 8:238/244 of query aligns to 7:249/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 98% coverage: 3:241/244 of query aligns to 1:244/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
41% identity, 98% coverage: 3:241/244 of query aligns to 2:245/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
41% identity, 98% coverage: 3:241/244 of query aligns to 2:245/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
41% identity, 98% coverage: 3:241/244 of query aligns to 2:245/344 of 3tuiC
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
38% identity, 96% coverage: 1:234/244 of query aligns to 1:238/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 89% coverage: 1:216/244 of query aligns to 1:220/615 of 5lilA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
40% identity, 91% coverage: 2:222/244 of query aligns to 3:226/648 of P75831
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
36% identity, 89% coverage: 1:216/244 of query aligns to 1:217/230 of 6z4wA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
42% identity, 85% coverage: 3:210/244 of query aligns to 3:215/226 of 5xu1B
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
38% identity, 86% coverage: 7:216/244 of query aligns to 8:217/229 of 6z67B
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 98% coverage: 2:239/244 of query aligns to 16:249/378 of P69874
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
42% identity, 88% coverage: 3:216/244 of query aligns to 3:216/223 of 2pclA
>HSERO_RS21250 HSERO_RS21250 amino acid ABC transporter ATP-binding protein
MPLIAIDNVKKRFGDNEVLKGISLDVEPGEVIAIIGKSGSGKSTLLRCINGLESIDEGNI
SVAGAKLGASELELRNLRLKVGMIFQQFNLFPHLSVGRNVMIAPMIVKGVSEAEAMKTAK
ANLEKVGLGHKFDAYPDQLSGGQQQRVAIARALSMSPQALLCDEITSALDPELVNEVLTV
MRGLAKEGMTLLMVTHEMRFAREVCNRLVFMHQGKVHEIGPPEELFGNPKTPELQQFIGM
TQGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory