Comparing HSERO_RS21310 FitnessBrowser__HerbieS:HSERO_RS21310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 8:493/518 of query aligns to 5:485/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 41% coverage: 10:223/518 of query aligns to 4:220/240 of 4ymuJ
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 37% coverage: 24:217/518 of query aligns to 17:206/348 of 3d31A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 43% coverage: 2:224/518 of query aligns to 13:233/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 41% coverage: 8:217/518 of query aligns to 2:219/343 of P30750
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 42% coverage: 8:225/518 of query aligns to 3:222/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 40% coverage: 15:223/518 of query aligns to 10:220/235 of 6mhzA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 41% coverage: 8:217/518 of query aligns to 3:220/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 41% coverage: 8:217/518 of query aligns to 3:220/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 41% coverage: 8:217/518 of query aligns to 3:220/344 of 3tuiC
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 40% coverage: 15:223/518 of query aligns to 10:220/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 40% coverage: 15:223/518 of query aligns to 10:220/238 of 6s8gA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 40% coverage: 15:223/518 of query aligns to 10:220/233 of 6b8bA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 40% coverage: 15:223/518 of query aligns to 10:220/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 40% coverage: 15:223/518 of query aligns to 10:220/234 of 4p31A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 42% coverage: 8:223/518 of query aligns to 3:220/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 42% coverage: 8:225/518 of query aligns to 4:224/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 42% coverage: 8:225/518 of query aligns to 4:224/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 42% coverage: 8:225/518 of query aligns to 4:224/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 42% coverage: 8:225/518 of query aligns to 4:224/242 of 2oljA
>HSERO_RS21310 FitnessBrowser__HerbieS:HSERO_RS21310
VSAVPLRLEISHVRKAYPGVLANDDVSLAVAPGEIHAVLGENGAGKSTLMKIIFGAVKPD
AGEIRWNGEAVQIANPQVARKLGIAMVFQHFSLFDTLTVTENIALGLDAKTDLKELAERI
TRTGEKYGLELEPQRHVHTLSVGERQRVEIVRALLTEPQLLILDEPTSVLTPQAVEKLFV
TLRRLADEGCSILYISHKLDEIRALCHSATVMRGGRVTGNCDPRNESSASLSRMMIGDEL
VRLQRERNPESMRNERKLHVNRLSLPKAHLFATELKDIECEVRAGEIVGIAGVSGNGQQE
LLAALSGEDQRAAPHMIMLGSKAVGDLSPNPRRAAGLGLVPEERLGRGAVPTLSLTANML
LSHQKAPYVKRGMIDFGFTRRAAASIIERFKVKAAGPDAPAKSLSGGNLQKFIVGREMER
KPAVFVVAQPTWGVDVGAAAQIHGEILKLKQEGCAVLVISEELDELFALCDRLHVIAKGR
LSPSIPIEQATREQVGVWMSGLWDEPAALDKGTEVGNG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory