SitesBLAST
Comparing HSERO_RS21535 FitnessBrowser__HerbieS:HSERO_RS21535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
60% identity, 97% coverage: 1:517/533 of query aligns to 1:518/521 of 4ykgA
- active site: C345 (= C344), C348 (= C347), D349 (= D348)
- binding flavin-adenine dinucleotide: G221 (= G223), P222 (= P224), A223 (= A225), G242 (≠ A244), E243 (= E245), G247 (= G249), Q248 (= Q250), T252 (= T254), N257 (= N259), S289 (≠ R291), A290 (= A292), T322 (= T321), G323 (= G322), C348 (= C347), G487 (= G486), D488 (= D487), Q496 (= Q495), I497 (= I496)
- binding nicotinamide-adenine-dinucleotide: I361 (= I360), G364 (= G363), S366 (= S365), E385 (= E384), F386 (= F385), I449 (= I448), M467 (≠ H466), P493 (= P492)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
60% identity, 97% coverage: 1:517/533 of query aligns to 1:518/521 of 4ykfA
- active site: C345 (= C344), C348 (= C347), D349 (= D348)
- binding flavin-adenine dinucleotide: G221 (= G223), P222 (= P224), A223 (= A225), G242 (≠ A244), E243 (= E245), G247 (= G249), Q248 (= Q250), N257 (= N259), A290 (= A292), T322 (= T321), G323 (= G322), C348 (= C347), N454 (= N453), D488 (= D487), Q496 (= Q495), I497 (= I496)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I360), G364 (= G363), N365 (= N364), S366 (= S365), E385 (= E384), F386 (= F385), K391 (= K390), I449 (= I448), M467 (≠ H466)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
60% identity, 97% coverage: 1:517/533 of query aligns to 1:518/521 of P35340
- K53 (≠ V53) modified: N6-acetyllysine
- K354 (= K353) modified: N6-acetyllysine
1hyuA Crystal structure of intact ahpf (see paper)
60% identity, 97% coverage: 1:517/533 of query aligns to 1:518/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G223), P222 (= P224), A223 (= A225), E243 (= E245), G247 (= G249), Q248 (= Q250), N257 (= N259), S289 (≠ R291), A290 (= A292), T322 (= T321), G323 (= G322), W326 (= W325), C345 (= C344), D488 (= D487), K495 (= K494), Q496 (= Q495), I497 (= I496)
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
40% identity, 56% coverage: 215:515/533 of query aligns to 5:304/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V251), L47 (≠ A256), N50 (= N259), C133 (= C344), C136 (= C347), D137 (= D348)
- binding flavin-adenine dinucleotide: V10 (= V220), G11 (= G221), A15 (= A225), D34 (≠ A244), K35 (≠ E245), G40 (= G249), L41 (≠ Q250), T42 (≠ V251), A45 (≠ T254), P46 (≠ L255), N50 (= N259), V82 (≠ I286), T110 (= T321), G111 (= G322), S154 (= S365), Q241 (≠ N453), G275 (= G486), D276 (= D487), A283 (≠ K494), Q284 (= Q495), I285 (= I496)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
37% identity, 57% coverage: 213:514/533 of query aligns to 5:307/310 of 3f8pD
- active site: C135 (= C344), C138 (= C347), D139 (= D348)
- binding nicotinamide-adenine-dinucleotide: V12 (= V220), G13 (= G221), L14 (≠ G222), G15 (= G223), P16 (= P224), A17 (= A225), G36 (≠ A244), T38 (≠ R246), G41 (= G249), Q42 (= Q250), I82 (≠ N288), V83 (= V289), G111 (≠ S320), I112 (≠ T321), G113 (= G322), G277 (= G486), D278 (= D487)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
36% identity, 57% coverage: 213:514/533 of query aligns to 5:305/308 of 3f8rA
- active site: C133 (= C344), C136 (= C347), D137 (= D348)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (= V220), G13 (= G221), L14 (≠ G222), G15 (= G223), P16 (= P224), A17 (= A225), E37 (= E245), T38 (≠ R246), G41 (= G249), Q42 (= Q250), I82 (≠ N288), V83 (= V289), G109 (≠ S320), I110 (≠ T321), G111 (= G322), R115 (= R326), L117 (≠ V328), D153 (≠ N364), S154 (= S365), E157 (= E368), R174 (≠ F385), R175 (≠ A386), Y184 (≠ L395), I236 (= I448), G275 (= G486), D276 (= D487), L282 (≠ V491), G283 (≠ P492), R285 (≠ K494)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
36% identity, 57% coverage: 213:514/533 of query aligns to 5:305/308 of 3f8dA
- active site: C133 (= C344), A136 (≠ C347), D137 (= D348)
- binding flavin-adenine dinucleotide: V12 (= V220), G13 (= G221), L14 (≠ G222), G15 (= G223), P16 (= P224), A17 (= A225), G36 (≠ A244), E37 (= E245), T38 (≠ R246), G41 (= G249), Q42 (= Q250), E45 (≠ D253), A46 (≠ T254), V49 (≠ I257), D51 (≠ N259), I82 (≠ N288), V83 (= V289), G109 (≠ S320), I110 (≠ T321), G111 (= G322), C133 (= C344), A136 (≠ C347), G275 (= G486), D276 (= D487), R285 (≠ K494), Q286 (= Q495), V287 (≠ I496)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
38% identity, 55% coverage: 212:506/533 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G221), G14 (= G223), P15 (= P224), A16 (= A225), F34 (≠ V243), E35 (≠ A244), K36 (≠ E245), G41 (= G249), A42 (≠ Q250), V83 (≠ R291), T112 (= T321), G113 (= G322), G276 (= G486), D277 (= D487)
- binding nicotinamide-adenine-dinucleotide: G153 (= G362), G154 (= G363), S156 (= S365), Q175 (≠ E384), N176 (≠ F385), T181 (≠ K390), V238 (≠ I448)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
34% identity, 56% coverage: 215:514/533 of query aligns to 5:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G223), P14 (= P224), A15 (= A225), E34 (≠ A244), Q35 (≠ E245), G40 (= G249), Q41 (= Q250), T45 (= T254), N50 (= N259), V82 (= V289), T110 (= T321), G111 (= G322), Y114 (≠ W325), C136 (= C347), V242 (≠ N453), G275 (= G486), D276 (= D487), Q284 (= Q495), I285 (= I496)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
33% identity, 56% coverage: 215:515/533 of query aligns to 2:301/303 of 5mh4A
- active site: V34 (vs. gap), P35 (vs. gap), M39 (≠ V251), E44 (≠ A256), C130 (= C344), C133 (= C347), D134 (= D348)
- binding flavin-adenine dinucleotide: G10 (= G223), P11 (= P224), A12 (= A225), E31 (= E245), R32 (= R246), G37 (= G249), Q38 (= Q250), T42 (= T254), N47 (= N259), G77 (≠ A294), V79 (= V296), T107 (= T321), G108 (= G322), E155 (≠ A369), V239 (≠ N453), F242 (≠ W456), G272 (= G486), D273 (= D487), Q281 (= Q495), I282 (= I496)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I360), G147 (= G361), G148 (= G362), G149 (= G363), D150 (≠ N364), S151 (= S365), E154 (= E368), H170 (≠ E384), R171 (≠ F385), R172 (≠ A386), R176 (≠ K390), V234 (≠ I448), G235 (= G449), R280 (≠ K494), Q281 (= Q495)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
35% identity, 55% coverage: 215:508/533 of query aligns to 8:304/313 of 2q7vA
- active site: P41 (vs. gap), I45 (≠ V251), E50 (≠ A256), C141 (= C344), C144 (= C347), D145 (= D348)
- binding flavin-adenine dinucleotide: G16 (= G223), P17 (= P224), A18 (= A225), E37 (≠ A244), K38 (≠ E245), G43 (= G249), Q44 (= Q250), I45 (≠ V251), N53 (= N259), E85 (≠ N288), V86 (= V289), T118 (= T321), G119 (= G322), C144 (= C347), G282 (= G486), D283 (= D487), Q291 (= Q495), L292 (≠ I496), S295 (≠ A499)
3r9uA Thioredoxin-disulfide reductase from campylobacter jejuni.
35% identity, 56% coverage: 216:514/533 of query aligns to 6:311/314 of 3r9uA
- active site: C137 (= C344), C140 (= C347), D141 (= D348)
- binding flavin-adenine dinucleotide: G11 (= G221), G12 (= G222), G13 (= G223), P14 (= P224), A15 (= A225), F34 (≠ A244), E35 (= E245), K36 (≠ R246), G41 (= G249), Q42 (= Q250), I43 (≠ V251), N51 (= N259), G83 (≠ Q290), V84 (≠ R291), T114 (= T321), G115 (= G322), T158 (≠ S365), R245 (≠ N453), G283 (= G486), D284 (= D487), K291 (= K494), Q292 (= Q495), V293 (≠ I496), A296 (= A499)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
34% identity, 59% coverage: 208:521/533 of query aligns to 11:337/356 of 5w4cA
- binding calcium ion: E99 (vs. gap), E116 (= E303), E118 (≠ K305)
- binding flavin-adenine dinucleotide: I23 (≠ V220), G24 (= G221), S25 (≠ G222), P27 (= P224), G28 (≠ A225), Y46 (vs. gap), G48 (= G241), A51 (= A244), F54 (= F247), G58 (= G249), Q59 (= Q250), L60 (≠ V251), T63 (= T254), N68 (= N259), V101 (= V289), T134 (= T321), G135 (= G322), G302 (= G486), D303 (= D487), R310 (≠ K494), Q311 (= Q495), A312 (≠ I496), S315 (≠ A499)
Sites not aligning to the query:
7aawA Thioredoxin reductase from bacillus cereus (see paper)
33% identity, 57% coverage: 209:510/533 of query aligns to 1:301/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G221), G15 (= G223), P16 (= P224), A17 (= A225), E36 (= E245), R37 (= R246), G42 (= G249), Q43 (= Q250), T47 (= T254), N52 (= N259), G82 (≠ V289), V84 (≠ R291), A111 (≠ S320), S112 (≠ T321), G113 (= G322), C138 (= C347), G277 (= G486), D278 (= D487), Q286 (= Q495), I287 (= I496)
- binding alpha-D-glucopyranose: R27 (= R235), D49 (≠ A256), K74 (≠ A281), F75 (≠ Y282), P122 (= P331), G123 (= G332), E126 (= E335), G129 (≠ N338), G131 (= G340), V132 (= V341), F143 (= F352), E206 (= E415), N208 (≠ T417)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
34% identity, 56% coverage: 215:510/533 of query aligns to 4:298/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G221), G12 (= G223), P13 (= P224), A14 (= A225), E33 (= E245), R34 (= R246), G39 (= G249), Q40 (= Q250), T44 (= T254), N49 (= N259), G79 (≠ V289), D80 (≠ Q290), V81 (≠ R291), S109 (≠ T321), G110 (= G322), Y113 (≠ W325), C135 (= C347), G274 (= G486), D275 (= D487), Q283 (= Q495), I284 (= I496)
- binding alpha-D-glucopyranose: D46 (≠ A256), E48 (= E258), G126 (≠ N338), G128 (= G340), D136 (= D348), A138 (≠ P350), F139 (≠ L351), F139 (≠ L351), F140 (= F352)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G362), G151 (= G363), D152 (≠ N364), S153 (= S365), E156 (= E368), H172 (≠ E384), R173 (≠ F385), R174 (≠ A386), R178 (≠ K390), I236 (= I448)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
36% identity, 56% coverage: 215:514/533 of query aligns to 5:303/309 of 4gcmB
- active site: C133 (= C344), C136 (= C347), D137 (= D348)
- binding flavin-adenine dinucleotide: G11 (= G221), G13 (= G223), P14 (= P224), A15 (= A225), E34 (= E245), R35 (= R246), G40 (= G249), Q41 (= Q250), T45 (= T254), N50 (= N259), D81 (= D285), I82 (= I286), T110 (= T321), G111 (= G322), C136 (= C347), G275 (= G486), D276 (= D487), Q284 (= Q495), I285 (= I496)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ V328), G151 (= G362), G152 (= G363), D153 (≠ N364), S154 (= S365), E157 (= E368), R174 (≠ F385), R175 (≠ A386), R179 (≠ K390), Q181 (≠ D392), I237 (= I448)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
33% identity, 56% coverage: 215:510/533 of query aligns to 4:299/306 of 5uthA
- active site: C133 (= C344), C136 (= C347), D137 (= D348)
- binding flavin-adenine dinucleotide: I9 (≠ V220), G10 (= G221), S11 (≠ G222), G12 (= G223), P13 (= P224), A14 (= A225), F32 (≠ V243), E33 (vs. gap), G34 (≠ A244), Q36 (≠ R246), G39 (= G249), A40 (≠ Q250), L41 (≠ V251), N49 (= N259), D81 (= D283), V82 (= V284), M110 (≠ T321), G111 (= G322), C136 (= C347), G275 (= G486), D276 (= D487), R283 (≠ K494), Q284 (= Q495), A285 (≠ I496), A288 (= A499)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
33% identity, 56% coverage: 215:510/533 of query aligns to 3:298/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ V220), G9 (= G221), S10 (≠ G222), G11 (= G223), P12 (= P224), A13 (= A225), E32 (vs. gap), G33 (≠ A244), Q35 (≠ R246), G38 (= G249), A39 (≠ Q250), L40 (≠ V251), T43 (= T254), N48 (= N259), D80 (= D283), V81 (= V284), M109 (≠ T321), G110 (= G322), T131 (≠ Y343), C135 (= C347), G274 (= G486), D275 (= D487), R282 (≠ K494), Q283 (= Q495), A284 (≠ I496), A287 (= A499)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R326), H115 (≠ N327), L116 (≠ V328), R173 (≠ F385), E200 (≠ Q412), I201 (≠ T413), I235 (= I448)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
33% identity, 56% coverage: 215:510/533 of query aligns to 3:298/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ V220), G9 (= G221), S10 (≠ G222), G11 (= G223), P12 (= P224), A13 (= A225), E32 (vs. gap), G33 (≠ A244), Q35 (≠ R246), G38 (= G249), A39 (≠ Q250), L40 (≠ V251), T43 (= T254), N48 (= N259), D80 (= D283), V81 (= V284), M109 (≠ T321), G110 (= G322), T131 (≠ Y343), C135 (= C347), G274 (= G486), D275 (= D487), R282 (≠ K494), Q283 (= Q495), A284 (≠ I496), A287 (= A499)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ V328), R173 (≠ F385), E200 (≠ Q412), I201 (≠ T413)
Query Sequence
>HSERO_RS21535 FitnessBrowser__HerbieS:HSERO_RS21535
MLDANLKTQLKAYLEKVSHPIEIVASLDDGAKSREMQELLQDIVLLSDRIKLVEQRGADA
QGRTPSFKLNRPGTDISVEFAAIPMGHEFTSLVLALLQVGGHPVKLDDKVIEQIKNLDGD
YRFETYVSLTCQNCPEVVQALNVMSIINPRIQSVTIDGALFQGEVEQRQIMAVPTVYMNG
EVFGQGRTGVEEILAKLDTGAAARKGEELSAKEPYDVLIVGGGPAGAAAAIYAARKGIRT
GVVAERFGGQVLDTLAIENFISVQETEGPQFATALEQHVKAYDVDIMNVQRAEALVPGDK
LIEVKLANGGVLKGKTVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVSVI
GGGNSGVEAAIDLAGIVAHVTLIEFAAELKADAVLVRKLKSLPNVTIVTSAQTTEITGDG
QRVNGISYKERETGEIKHVPLEGVFVQIGLVPNTEWLKGTLALSKHGEIEIDAKGQTSIP
GVFAAGDVTTVPYKQIVIAVGAGATAALSAFDHLIRSSADDVAPAAAKEAVAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory