Comparing HSERO_RS21615 FitnessBrowser__HerbieS:HSERO_RS21615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
45% identity, 81% coverage: 51:270/271 of query aligns to 8:226/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
44% identity, 82% coverage: 51:271/271 of query aligns to 8:225/225 of 4zv2A
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 87% coverage: 37:271/271 of query aligns to 1:232/241 of 2q2aA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
40% identity, 85% coverage: 43:271/271 of query aligns to 1:226/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
41% identity, 82% coverage: 50:271/271 of query aligns to 4:222/231 of 2q2cA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
41% identity, 81% coverage: 51:269/271 of query aligns to 14:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 82% coverage: 50:271/271 of query aligns to 13:229/229 of 6svfA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
35% identity, 81% coverage: 51:269/271 of query aligns to 8:226/234 of 3k4uE
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
33% identity, 83% coverage: 46:269/271 of query aligns to 13:234/235 of 4g4pA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
35% identity, 81% coverage: 49:268/271 of query aligns to 18:235/239 of 4zefA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
30% identity, 84% coverage: 43:269/271 of query aligns to 1:226/230 of 4kqpA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
29% identity, 82% coverage: 51:271/271 of query aligns to 21:236/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
29% identity, 82% coverage: 51:271/271 of query aligns to 21:236/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
29% identity, 82% coverage: 51:271/271 of query aligns to 21:236/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
29% identity, 82% coverage: 51:271/271 of query aligns to 17:232/237 of 3vv5A
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
29% identity, 81% coverage: 51:269/271 of query aligns to 30:253/260 of P0AEU0
Sites not aligning to the query:
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
30% identity, 82% coverage: 48:269/271 of query aligns to 2:222/224 of 4ymxA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
31% identity, 82% coverage: 50:270/271 of query aligns to 6:222/226 of 8eyzA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
27% identity, 86% coverage: 38:269/271 of query aligns to 18:253/260 of P02911
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
33% identity, 80% coverage: 51:268/271 of query aligns to 4:219/223 of 8b5dA
>HSERO_RS21615 FitnessBrowser__HerbieS:HSERO_RS21615
MIKMFTRHARALALTAGFVGMLGLAACGKQEDKSATAAAPQAAAPARVYVVGVESAYAPF
SSENEQKDVVGFDIDIMKALAKKIGIEVKFVPTPFEGFFNFLAQGDRDLLISAITITDER
KKSVAFSEPYFVATQTIALPAADTKVSKMEDLKPLTVGTQSATSGDELVQQVLGKNSAKI
KRFDSTPLALKELESGGVDAVVADEPVVKNYIANNPNSKLRTVTDPSFPKEDYGIAVRKD
DPELLAKINKGLAEMKADGSFAAISAQYFGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory