Comparing HSERO_RS21910 FitnessBrowser__HerbieS:HSERO_RS21910 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 81% coverage: 29:240/263 of query aligns to 34:247/265 of P07821
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 84% coverage: 8:228/263 of query aligns to 20:235/378 of P69874
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 86% coverage: 4:228/263 of query aligns to 5:230/375 of 2d62A
1g291 Malk (see paper)
32% identity, 82% coverage: 14:228/263 of query aligns to 12:227/372 of 1g291
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 86% coverage: 6:230/263 of query aligns to 3:225/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
25% identity, 82% coverage: 15:229/263 of query aligns to 14:238/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
25% identity, 82% coverage: 15:229/263 of query aligns to 14:238/253 of 1g9xB
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
35% identity, 82% coverage: 28:243/263 of query aligns to 21:234/248 of 4fi3C
Sites not aligning to the query:
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
35% identity, 81% coverage: 28:240/263 of query aligns to 21:231/231 of 1l7vC
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
30% identity, 81% coverage: 15:228/263 of query aligns to 16:216/353 of 1vciA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 86% coverage: 4:228/263 of query aligns to 2:221/369 of P19566
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
33% identity, 93% coverage: 3:246/263 of query aligns to 1:244/350 of 3fvqB
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 89% coverage: 20:253/263 of query aligns to 23:256/648 of P75831
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
28% identity, 89% coverage: 4:238/263 of query aligns to 1:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
28% identity, 89% coverage: 4:238/263 of query aligns to 1:233/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
28% identity, 89% coverage: 4:238/263 of query aligns to 1:233/235 of 6mhzA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
28% identity, 89% coverage: 4:238/263 of query aligns to 1:233/233 of 6b8bA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
28% identity, 89% coverage: 4:238/263 of query aligns to 1:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
28% identity, 89% coverage: 4:238/263 of query aligns to 1:233/234 of 4p31A
7arlD Lolcde in complex with lipoprotein and adp (see paper)
36% identity, 71% coverage: 32:219/263 of query aligns to 32:220/222 of 7arlD
>HSERO_RS21910 FitnessBrowser__HerbieS:HSERO_RS21910
MNTASLCVAGLKVAYGRHSVIQGLDLPELTAGSVTALLGPNGSGKSTLLRTLGGLTRAQA
GSVRLGPTELAQADAAARAQHVVYMPQSLPRPVHLSVFESVLVAAQALQRTRPDTQELER
VQALLQHLGIGHLAQRHLDELSGGQRQLAALAQALVRRPRVLLLDEPLSALDLNYQYLVM
DLLRQETRLHGLVTLVVLHDLNTAFRHVDRALLLHQGRLLCAGAAREVITPATLAQAYGV
DGRIEFCSQGYGQVQIDGLLSVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory