Comparing HSERO_RS21960 FitnessBrowser__HerbieS:HSERO_RS21960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3fijA Crystal structure of a uncharacterized protein lin1909
40% identity, 44% coverage: 192:358/378 of query aligns to 42:208/224 of 3fijA
7d53A Spua mutant - h221n with glu (see paper)
40% identity, 45% coverage: 192:360/378 of query aligns to 58:232/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
40% identity, 45% coverage: 192:360/378 of query aligns to 64:238/255 of 7d50B
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 42% coverage: 192:350/378 of query aligns to 124:279/308 of O33341
Sites not aligning to the query:
7d4rB Spua native structure (see paper)
42% identity, 35% coverage: 230:360/378 of query aligns to 65:200/215 of 7d4rB
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
29% identity, 58% coverage: 135:352/378 of query aligns to 5:224/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
29% identity, 58% coverage: 135:352/378 of query aligns to 7:226/254 of P76038
>HSERO_RS21960 FitnessBrowser__HerbieS:HSERO_RS21960
MSDIQDSEANLPPDRPSTPAQPVSADASGTPAASQTPAPAAAAPAAPAPVAAAAPPAVPP
AQPSPESAPAGQAQQAQQSAHSPYSAVPPPHHAGDAPWAQTWRFLTARLRQLSDKAGRRV
MQRTLKIGVSARIFHPEAGAKGLRSKTLQYLEESIAQWVMSRDVLVFMIPTVNTNGLVHP
SNIRLRDYAKHLDGLVLQGGADVSPQSYAQSATRPEWSGDRVRDMYELELLHEFIEAGKP
VLGICRGCQLINVAFGGTLYQDIATDVPTAIPHVNEQYDSNYHTLHFPQGSSLANLLKAE
NAVVNSIHHQAVRDLGRDLSVEAVSGPDQIVEAIRYRKAPFVMGLQWHPEFHRAGSPELL
DCTPVLDSFLRAARETRF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory