SitesBLAST
Comparing HSERO_RS22025 FitnessBrowser__HerbieS:HSERO_RS22025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3tatA Tyrosine aminotransferase from e. Coli (see paper)
55% identity, 99% coverage: 1:394/396 of query aligns to 1:397/397 of 3tatA
- active site: W131 (= W128), D212 (= D209), A214 (= A211), K247 (= K244)
- binding pyridoxal-5'-phosphate: G103 (= G100), G104 (= G101), S105 (= S102), H179 (= H176), N184 (= N181), A214 (= A211), S246 (= S243), K247 (= K244), R255 (= R252)
3fslA Crystal structure of tyrosine aminotransferase tripple mutant (p181q, r183g,a321k) from escherichia coli at 2.35 a resolution
55% identity, 99% coverage: 1:394/396 of query aligns to 1:397/397 of 3fslA
- active site: W131 (= W128), D212 (= D209), A214 (= A211), K247 (= K244)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G103 (= G100), G104 (= G101), S105 (= S102), W131 (= W128), N184 (= N181), D212 (= D209), A214 (= A211), Y215 (= Y212), S244 (= S241), S246 (= S243), K247 (= K244), R255 (= R252)
6zvgA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with substrate analog - l-indole-3-lactic acid (see paper)
50% identity, 100% coverage: 1:395/396 of query aligns to 1:397/398 of 6zvgA
- binding 3-(indol-3-yl) lactate: D11 (= D11), I13 (= I13), L14 (= L14), I33 (= I33), G34 (= G34), W130 (= W128), K246 (= K244), R374 (= R372)
- binding pyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
6zurA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with substrate analog - l-p-hydroxyphenyllactic acid (see paper)
50% identity, 100% coverage: 1:395/396 of query aligns to 1:397/398 of 6zurA
- binding pyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), D211 (= D209), A213 (= A211), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
- binding (2S)-2-hydroxy-3-(4-hydroxyphenyl)propanoic acid: G34 (= G34), W130 (= W128), R374 (= R372)
6zupA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with substrate analog - l-(-)-3-phenyllactic acid (see paper)
50% identity, 100% coverage: 1:395/396 of query aligns to 1:397/398 of 6zupA
- binding alpha-hydroxy-beta-phenyl-propionic acid: I13 (= I13), I33 (= I33), G34 (= G34), W130 (= W128), K246 (= K244), R374 (= R372)
- binding pyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), N183 (= N181), D211 (= D209), A213 (= A211), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
4rkdC Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with aspartic acid (see paper)
50% identity, 100% coverage: 1:395/396 of query aligns to 1:397/398 of 4rkdC
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding oxaloacetate ion: Y65 (= Y65), R280 (= R278)
- binding pyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
4rkdA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 cocrystalized with aspartic acid (see paper)
50% identity, 100% coverage: 1:395/396 of query aligns to 1:397/398 of 4rkdA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethylene)-amino]-succinic acid: G34 (= G34), G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), D211 (= D209), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
- binding pyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), D211 (= D209), A213 (= A211), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
4rkcA Psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. B6 (see paper)
50% identity, 100% coverage: 1:395/396 of query aligns to 1:397/398 of 4rkcA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), D211 (= D209), A213 (= A211), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
1ahxA Aspartate aminotransferase hexamutant (see paper)
41% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1ahxA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding hydrocinnamic acid: I13 (= I13), L14 (= L14), G34 (= G34), W130 (= W128), K246 (= K244), R374 (= R372)
- binding pyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), N183 (= N181), D211 (= D209), A213 (= A211), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
1ahgA Aspartate aminotransferase hexamutant (see paper)
41% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1ahgA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding pyridoxal-5'-phosphate: G103 (= G101), S104 (= S102), W130 (= W128), N183 (= N181), D211 (= D209), S243 (= S241), S245 (= S243), R254 (= R252)
- binding tyrosine: D11 (= D11), I13 (= I13), L14 (= L14), W130 (= W128), R374 (= R372)
1ahfA Aspartate aminotransferase hexamutant (see paper)
41% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1ahfA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding indolylpropionic acid: I13 (= I13), L14 (= L14), I33 (= I33), G34 (= G34), W130 (= W128), R374 (= R372)
- binding pyridoxal-5'-phosphate: G102 (= G100), G103 (= G101), S104 (= S102), W130 (= W128), N183 (= N181), D211 (= D209), A213 (= A211), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
5vwrA E.Coli aspartate aminotransferase-(1r,3s,4s)-3-amino-4- fluorocyclopentane-1-carboxylic acid (fcp)-alpha-ketoglutarate (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 5vwrA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-glutamic acid: I13 (= I13), G34 (= G34), G102 (= G100), G103 (= G101), T104 (≠ S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252), R374 (= R372)
5t4lA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 5t4lA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding (4R)-4-amino-6-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}hexanoic acid: G102 (= G100), G103 (= G101), T104 (≠ S102), W130 (= W128), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
3qpgA Crystal structures of escherichia coli aspartate aminotransferase reconstituted with 1-deaza-pyridoxal 5'-phosphate: internal aldimine and stable l-aspartate external aldimine (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 3qpgA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding (E)-N-{2-hydroxy-3-methyl-6-[(phosphonooxy)methyl]benzylidene}-L-aspartic acid: I13 (= I13), G34 (= G34), G102 (= G100), G103 (= G101), T104 (≠ S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252), R374 (= R372)
3pa9A Mechanism of inactivation of e. Coli aspartate aminotransferase by (s)-4-amino-4,5-dihydro-2-furancarboxylic acid (s-adfa) ph 7.5 (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 3pa9A
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding 4-aminofuran-2-carboxylic acid: G34 (= G34), W130 (= W128), K246 (= K244), F348 (= F346), R374 (= R372)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G103 (= G101), T104 (≠ S102), W130 (= W128), D211 (= D209), A213 (= A211), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252)
1x2aA Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-d- glutamic acid (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1x2aA
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: I33 (= I33), G34 (= G34), Y65 (= Y65), G102 (= G100), G103 (= G101), T104 (≠ S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252), R280 (= R278), F348 (= F346), R374 (= R372)
1x29A Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-2- methyl-l-glutamic acid (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1x29A
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-2-methyl-l-glutamic acid: I13 (= I13), G34 (= G34), Y65 (= Y65), G103 (= G101), T104 (≠ S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252), R280 (= R278), F348 (= F346), R374 (= R372)
1x28A Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-l- glutamic acid (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1x28A
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I13 (= I13), Y65 (= Y65), G103 (= G101), T104 (≠ S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252), R280 (= R278), F348 (= F346), R374 (= R372)
1cq8A Aspartate aminotransferase (E.C. 2.6.1.1) complexed with c6-pyridoxal- 5p-phosphate (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1cq8A
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: I33 (= I33), G34 (= G34), G103 (= G101), T104 (≠ S102), W130 (= W128), N183 (= N181), D211 (= D209), A213 (= A211), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252), R374 (= R372)
1cq7A Aspartate aminotransferase (E.C. 2.6.1.1) complexed with c5-pyridoxal- 5p-phosphate (see paper)
40% identity, 99% coverage: 1:394/396 of query aligns to 1:396/396 of 1cq7A
- active site: W130 (= W128), D211 (= D209), A213 (= A211), K246 (= K244)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: I13 (= I13), I33 (= I33), G34 (= G34), G103 (= G101), T104 (≠ S102), W130 (= W128), N183 (= N181), D211 (= D209), Y214 (= Y212), S243 (= S241), S245 (= S243), K246 (= K244), R254 (= R252), R374 (= R372)
Query Sequence
>HSERO_RS22025 FitnessBrowser__HerbieS:HSERO_RS22025
MFSHLPPYAGDPILSLMEQFQRDERSNKVNLSIGIYTDGKGVVPVLPSVRTAAAAVAQAD
APYVYLPMEGHGAYRQAVAKLLFGADLPAPEHLAIVQTLGGSGALKVGADLIARFFPQPT
IWLPDPTWDNHIGIFEGAGFKTERYPYYDAQTKGLNFEGMLAKIDSLPRGAVVLLHPCCH
NPTGVDPTRAQWEQIVEVVEKRGLLPFFDLAYQGFAESLDEDIWPVREAVRRQIPFFLSN
SFSKIFSLYSERIGALSVFCPQAGQAANVLGQLKLTVRRNYSSPPRNGALLVAHVLGDDK
LAAQWRGEVEEMRVRVRDMRVKLASQLKSAVPDQDFSFLLRQNGMFGYTGLSSAQVDRLR
EEFGVYAVGTGRICVAGLNDSNVARVAETMAEVLRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory