SitesBLAST
Comparing HSERO_RS22045 FitnessBrowser__HerbieS:HSERO_RS22045 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
61% identity, 99% coverage: 3:334/336 of query aligns to 4:343/345 of 1hzjA
- active site: S131 (= S124), A132 (= A125), T133 (= T126), Y156 (= Y148), K160 (= K152)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ C34), N36 (= N35), D65 (= D58), I66 (= I59), F87 (= F80), A88 (= A81), G89 (= G82), K91 (= K84), S129 (= S122), S131 (= S124), Y156 (= Y148), K160 (= K152), Y184 (= Y176), P187 (= P179)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N178), N206 (= N198), L207 (= L199), N223 (= N215), V224 (≠ I216), F225 (≠ W217), R238 (= R230), Y240 (≠ F232), V276 (= V267), R299 (= R290), D302 (= D293)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
60% identity, 99% coverage: 3:334/336 of query aligns to 4:343/347 of 1i3lA
- active site: S131 (= S124), A132 (= A125), T133 (= T126), Y156 (= Y148), K160 (= K152)
- binding galactose-uridine-5'-diphosphate: N186 (= N178), N206 (= N198), L207 (= L199), N223 (= N215), V224 (≠ I216), F225 (≠ W217), R238 (= R230), Y240 (≠ F232), V276 (= V267), R299 (= R290), D302 (= D293)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ C34), N36 (= N35), D65 (= D58), I66 (= I59), F87 (= F80), A88 (= A81), G89 (= G82), K91 (= K84), S129 (= S122), S130 (= S123), S131 (= S124), Y156 (= Y148), K160 (= K152), Y184 (= Y176), P187 (= P179)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
60% identity, 99% coverage: 3:334/336 of query aligns to 4:343/347 of 1i3kA
- active site: S131 (= S124), A132 (= A125), T133 (= T126), Y156 (= Y148), K160 (= K152)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), H35 (≠ C34), N36 (= N35), D65 (= D58), I66 (= I59), F87 (= F80), A88 (= A81), G89 (= G82), K91 (= K84), S129 (= S122), S131 (= S124), Y156 (= Y148), K160 (= K152), Y184 (= Y176), P187 (= P179)
- binding uridine-5'-diphosphate-glucose: F185 (= F177), N186 (= N178), N206 (= N198), L207 (= L199), N223 (= N215), V224 (≠ I216), F225 (≠ W217), R238 (= R230), Y240 (≠ F232), V276 (= V267), R299 (= R290), D302 (= D293)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
61% identity, 99% coverage: 3:334/336 of query aligns to 5:344/348 of Q14376
- GYI 12:14 (= GYI 10:12) binding
- DNFHN 33:37 (≠ DNFCN 31:35) binding
- N34 (= N32) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (= DI 58:59) binding
- F88 (= F80) binding
- G90 (= G82) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (= K84) binding
- V94 (= V86) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ M95) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S124) mutation to A: Loss of activity.
- SAT 132:134 (= SAT 124:126) binding
- Y157 (= Y148) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K152) binding
- A180 (≠ I171) to V: in dbSNP:rs3204468
- L183 (= L174) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y176) binding
- YFN 185:187 (= YFN 176:178) binding
- NNL 206:208 (= NNL 197:199) binding
- NVF 224:226 (≠ NIW 215:217) binding
- R239 (= R230) binding
- K257 (≠ A248) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPGD 290:293) binding
- C307 (= C297) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ E303) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G309) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ K325) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
61% identity, 99% coverage: 3:334/336 of query aligns to 5:344/346 of 1ek6A
- active site: S132 (= S124), A133 (= A125), T134 (= T126), Y157 (= Y148), K161 (= K152)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G7), G12 (= G10), Y13 (= Y11), I14 (= I12), D33 (= D31), N34 (= N32), H36 (≠ C34), N37 (= N35), D66 (= D58), I67 (= I59), F88 (= F80), A89 (= A81), G90 (= G82), K92 (= K84), S130 (= S122), S131 (= S123), S132 (= S124), Y157 (= Y148), K161 (= K152), Y185 (= Y176), P188 (= P179)
- binding uridine-5'-diphosphate-glucose: S132 (= S124), Y157 (= Y148), F186 (= F177), N187 (= N178), N207 (= N198), L208 (= L199), N224 (= N215), V225 (≠ I216), F226 (≠ W217), R239 (= R230), Y241 (≠ F232), V277 (= V267), R300 (= R290), D303 (= D293)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
60% identity, 99% coverage: 2:334/336 of query aligns to 6:339/340 of 3enkA
- active site: S127 (= S123), S128 (= S124), T130 (= T126), Y152 (= Y148), K156 (= K152)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G14 (= G10), Y15 (= Y11), I16 (= I12), D35 (= D31), N36 (= N32), V38 (≠ C34), N39 (= N35), S40 (= S36), D62 (= D58), V63 (≠ I59), F84 (= F80), A85 (= A81), A86 (≠ G82), K88 (= K84), N103 (= N99), S126 (= S122), S128 (= S124), Y152 (= Y148), K156 (= K152), Y180 (= Y176), P183 (= P179)
- binding uridine-5'-diphosphate-glucose: T130 (= T126), N182 (= N178), N201 (= N197), N202 (= N198), L203 (= L199), R219 (≠ N215), V220 (≠ I216), F221 (≠ W217), R234 (= R230), Y236 (≠ F232), V272 (= V267), R295 (= R290), D298 (= D293)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
58% identity, 99% coverage: 2:334/336 of query aligns to 2:335/335 of 6k0iA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (= N32), N35 (= N35), S36 (= S36), D58 (= D58), V59 (≠ I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), N99 (= N99), S122 (= S122), S123 (= S123), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-5'-diphosphate-glucose: K84 (= K84), S124 (= S124), Y149 (= Y148), F178 (= F177), N179 (= N178), A198 (≠ N197), N199 (= N198), L200 (= L199), Q216 (≠ N215), V217 (≠ I216), Y218 (≠ W217), R231 (= R230), Y233 (≠ F232), V268 (= V267), R291 (= R290), D294 (= D293)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
58% identity, 99% coverage: 2:334/336 of query aligns to 2:335/335 of 6k0hA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (= N32), G34 (≠ C34), N35 (= N35), S36 (= S36), D58 (= D58), V59 (≠ I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), N99 (= N99), S123 (= S123), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (= K84), S124 (= S124), Y149 (= Y148), F178 (= F177), N179 (= N178), A198 (≠ N197), N199 (= N198), L200 (= L199), Q216 (≠ N215), V217 (≠ I216), Y218 (≠ W217), R231 (= R230), Y233 (≠ F232), V268 (= V267), R291 (= R290), D294 (= D293)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
58% identity, 99% coverage: 2:334/336 of query aligns to 2:335/335 of 6k0gA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152)
- binding magnesium ion: E66 (= E66), H114 (≠ T114)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (≠ Y11), I12 (= I12), D31 (= D31), N32 (= N32), N35 (= N35), S36 (= S36), D58 (= D58), V59 (≠ I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), N99 (= N99), S122 (= S122), S123 (= S123), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-5'-diphosphate: N179 (= N178), A198 (≠ N197), N199 (= N198), L200 (= L199), Q216 (≠ N215), V217 (≠ I216), Y218 (≠ W217), R231 (= R230), Y233 (≠ F232), V268 (= V267), R291 (= R290), D294 (= D293)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
56% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of 2udpA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152), M189 (≠ I188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (= C34), N35 (= N35), S36 (= S36), D58 (= D58), I59 (= I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), S122 (= S122), S124 (= S124), Y149 (= Y148), K153 (= K152), Y177 (= Y176)
- binding phenyl-uridine-5'-diphosphate: N179 (= N178), N199 (= N198), L200 (= L199), A216 (≠ N215), I217 (= I216), F218 (≠ W217), R231 (= R230), Y233 (≠ F232), V269 (= V267), R292 (= R290), D295 (= D293)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
56% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of 1udcA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152), M189 (≠ I188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), C34 (= C34), N35 (= N35), S36 (= S36), D58 (= D58), I59 (= I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), S122 (= S122), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-5'-diphosphate-mannose: T126 (= T126), Y149 (= Y148), N179 (= N178), N199 (= N198), L200 (= L199), L215 (= L214), A216 (≠ N215), I217 (= I216), F218 (≠ W217), R231 (= R230), Y233 (≠ F232), V269 (= V267), R292 (= R290)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
56% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of P09147
- YI 11:12 (= YI 11:12) binding
- DNLCNS 31:36 (≠ DNFCNS 31:36) binding
- DI 58:59 (= DI 58:59) binding
- FAGLK 80:84 (= FAGLK 80:84) binding
- N99 (= N99) binding
- S124 (= S124) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y148) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K152) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F177) binding
- Y299 (≠ C297) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
56% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of 1udaA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152), M189 (≠ I188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (= C34), N35 (= N35), S36 (= S36), D58 (= D58), I59 (= I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), S122 (= S122), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T126), N179 (= N178), N199 (= N198), L200 (= L199), A216 (≠ N215), I217 (= I216), F218 (≠ W217), R231 (= R230), Y233 (≠ F232), R292 (= R290), D295 (= D293), Y299 (≠ C297)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
56% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of 1naiA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152), M189 (≠ I188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (= C34), N35 (= N35), S36 (= S36), D58 (= D58), I59 (= I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding 1,3-propandiol: N35 (= N35), K84 (= K84), E191 (= E190), P193 (= P192)
- binding uridine-5'-diphosphate: N179 (= N178), N199 (= N198), L200 (= L199), L215 (= L214), A216 (≠ N215), R231 (= R230), Y233 (≠ F232), R292 (= R290)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
56% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of 1lrjA
- active site: S124 (= S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152), M189 (≠ I188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), L33 (≠ F33), C34 (= C34), N35 (= N35), S36 (= S36), D58 (= D58), I59 (= I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V86), S124 (= S124), F178 (= F177), N179 (= N178), L200 (= L199), L215 (= L214), A216 (≠ N215), F218 (≠ W217), R231 (= R230), Y233 (≠ F232), V269 (= V267), R292 (= R290), D295 (= D293)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
56% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of 1kvrA
- active site: A124 (≠ S124), A125 (= A125), T126 (= T126), Y149 (= Y148), K153 (= K152), M189 (≠ I188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), C34 (= C34), N35 (= N35), S36 (= S36), D58 (= D58), I59 (= I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), S122 (= S122), S123 (= S123), Y149 (= Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-5'-diphosphate: N179 (= N178), N198 (= N197), N199 (= N198), L200 (= L199), A216 (≠ N215), I217 (= I216), F218 (≠ W217), R231 (= R230), Y233 (≠ F232), V269 (= V267), R292 (= R290), D295 (= D293)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
58% identity, 99% coverage: 2:334/336 of query aligns to 3:342/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), N36 (= N35), D62 (= D58), L63 (≠ I59), F84 (= F80), A85 (= A81), G86 (= G82), K88 (= K84), N103 (= N99), S126 (= S122), S128 (= S124), Y152 (= Y148), K156 (= K152), Y180 (= Y176), P183 (= P179)
- binding uridine-5'-diphosphate-glucose: S128 (= S124), A129 (= A125), F181 (= F177), N182 (= N178), N202 (= N198), L203 (= L199), T219 (≠ N215), V220 (≠ I216), Y221 (≠ W217), R234 (= R230), Y236 (≠ F232), V275 (= V267), R298 (= R290), D301 (= D293)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
58% identity, 99% coverage: 2:334/336 of query aligns to 3:342/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), Y12 (= Y11), I13 (= I12), D32 (= D31), N33 (= N32), N36 (= N35), D62 (= D58), L63 (≠ I59), F84 (= F80), A85 (= A81), G86 (= G82), K88 (= K84), N103 (= N99), S126 (= S122), S128 (= S124), Y152 (= Y148), K156 (= K152), Y180 (= Y176), P183 (= P179)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N178), N202 (= N198), L203 (= L199), T219 (≠ N215), Y221 (≠ W217), R234 (= R230), Y236 (≠ F232), V275 (= V267), R298 (= R290), D301 (= D293)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
55% identity, 99% coverage: 1:334/336 of query aligns to 1:336/338 of 1a9yA
- active site: A124 (≠ S124), A125 (= A125), T126 (= T126), F149 (≠ Y148), K153 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (= Y11), I12 (= I12), D31 (= D31), N32 (= N32), C34 (= C34), N35 (= N35), S36 (= S36), D58 (= D58), I59 (= I59), F80 (= F80), A81 (= A81), G82 (= G82), K84 (= K84), S122 (= S122), S123 (= S123), F149 (≠ Y148), K153 (= K152), Y177 (= Y176), P180 (= P179)
- binding uridine-5'-diphosphate-glucose: A125 (= A125), T126 (= T126), N179 (= N178), N199 (= N198), L200 (= L199), A216 (≠ N215), I217 (= I216), F218 (≠ W217), R231 (= R230), Y233 (≠ F232), R292 (= R290), D295 (= D293), Y299 (≠ C297)
Q564Q1 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Caenorhabditis elegans (see paper)
52% identity, 100% coverage: 1:336/336 of query aligns to 1:349/349 of Q564Q1
- P314 (= P301) mutation to L: In pv18; at the restrictive temperature of 25 degrees Celsius, embryos have cell-cell adhesion defects and die before hatching. The few surviving animals are arrested at the L1 larval stage. At the permissive temperature of 16-20 degrees Celsius, causes a developmental delay. Distal tip cell migration is impaired due to a reduced localization of metalloprotease mig-17 to the gonad basement membrane. Vulva lumen is smaller at the L4 larval stage. Accumulation of UDP-galactose (Gal) and reduction in UDP-N-acetylgalactosamine (GalNAc) levels. Hypersensitivity to a galactose-rich diet characterized by a slow development often resulting in an arrest at the L1 larval stage. Up-regulation of ER stress response protein hsp-4; expression is suppressed in an xbp-1 RNAi-mediated knockdown animals. Reduced survival upon E.faecalis or S.aureus-mediated infection.
Query Sequence
>HSERO_RS22045 FitnessBrowser__HerbieS:HSERO_RS22045
MNILVTGGAGYIGSHTCVELLKAGHEVIVFDNFCNSSPESVKRVQQITGKTLSLVKGDIR
NREQLESVLREFKCEAVIHFAGLKAVGESVEQPLMYYDNNVVGTVRLLEAMQATGVKTIV
FSSSATVYGDPQYLPLDEAHPLSASNPYGRSKIVIEDMLRDYYRAHPDWKIALLRYFNPV
GAHESGLIGEDPGGIPNNLMPFVAQVAIGRRERLNIWGGDYPTPDGTGVRDFIHVVDLAR
GHVAALQALDAPQCFAVNLGTGVGYSVLDVLKAYEKACGKTLPYAIAERRPGDIASCYAN
PAEAKRKLGWEATLGLEAMCADSWKWQQMNPNGFKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory