Comparing HSERO_RS22225 FitnessBrowser__HerbieS:HSERO_RS22225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
39% identity, 95% coverage: 17:325/325 of query aligns to 2:321/321 of 4wzzA
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
30% identity, 94% coverage: 17:321/325 of query aligns to 5:319/321 of 4pz0A
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
31% identity, 93% coverage: 21:321/325 of query aligns to 5:314/316 of 1tjyA
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
34% identity, 86% coverage: 21:299/325 of query aligns to 3:278/314 of 3t95A
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
31% identity, 86% coverage: 21:301/325 of query aligns to 3:281/315 of 3ejwA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
32% identity, 78% coverage: 33:287/325 of query aligns to 19:268/289 of 5hqjA
Sites not aligning to the query:
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
23% identity, 86% coverage: 20:299/325 of query aligns to 1:288/326 of 6dspA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 74% coverage: 18:256/325 of query aligns to 1:242/287 of 5dteB
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
24% identity, 81% coverage: 18:280/325 of query aligns to 5:263/283 of 6gt9A
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
24% identity, 74% coverage: 33:274/325 of query aligns to 14:250/313 of 2h3hA
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
24% identity, 79% coverage: 24:280/325 of query aligns to 6:258/278 of 6guqA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
24% identity, 74% coverage: 33:274/325 of query aligns to 14:250/305 of 3c6qC
Sites not aligning to the query:
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
27% identity, 81% coverage: 19:280/325 of query aligns to 4:267/295 of 4rxtA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
24% identity, 76% coverage: 21:266/325 of query aligns to 2:248/290 of 4wutA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
26% identity, 75% coverage: 23:266/325 of query aligns to 5:253/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
26% identity, 75% coverage: 23:266/325 of query aligns to 5:253/288 of 8wl9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
25% identity, 75% coverage: 23:266/325 of query aligns to 5:253/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
25% identity, 75% coverage: 23:266/325 of query aligns to 5:253/288 of 1gudA
Sites not aligning to the query:
4pe6B Crystal structure of abc transporter solute binding protein from thermobispora bispora dsm 43833
29% identity, 59% coverage: 19:211/325 of query aligns to 1:194/324 of 4pe6B
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
29% identity, 59% coverage: 19:210/325 of query aligns to 1:194/292 of 2fn8A
Sites not aligning to the query:
>HSERO_RS22225 FitnessBrowser__HerbieS:HSERO_RS22225
LAAGAIGLIAAAPAHAAEKVRIAMVVKSLGNGFFDAAHEGAKEAARELGDVEVIYTGPTT
PTAEGQIEIVNSLISQKVDAIVISANDANALVPITKRAMQRGVKVLSFDSGIAKGGRLMQ
LNPSNAELIGLKQIQMAAEAIGGAGDVAILSATAQATNQNIWIGEMKKALARPEFSRMKL
VATVYGDDQSDKSYREAIGLLRSHPGLKAIIAPTTVGINAAGKAVVDEKLVGKVYVTGLG
LPSEMAGHVKSGAVKSFAIWNPIDLGYAATYAAYQFVKGKAQGKEGESIAVGRMGSIKLD
AAGEAALAPPFTYDASNVDKFAKIF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory