SitesBLAST
Comparing HSERO_RS22235 FitnessBrowser__HerbieS:HSERO_RS22235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 38% coverage: 425:683/690 of query aligns to 4:251/255 of 5itvA
- active site: G18 (= G439), S141 (= S567), Y154 (= Y580), K158 (= K584)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G435), S17 (≠ G438), G18 (= G439), I19 (= I440), D38 (= D459), I39 (= I460), T61 (≠ A486), I63 (= I488), N89 (= N514), G91 (= G516), T139 (≠ V565), S141 (= S567), Y154 (= Y580), K158 (= K584), P184 (= P610), G185 (≠ D611), I186 (= I619), I187 (≠ W620)
8dt1C Crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with NAD
35% identity, 38% coverage: 425:683/690 of query aligns to 1:255/259 of 8dt1C
- binding nicotinamide-adenine-dinucleotide: G11 (= G435), S14 (≠ G438), G15 (= G439), I16 (= I440), D35 (= D459), L36 (≠ I460), M60 (≠ R485), V62 (≠ I488), N88 (= N514), A89 (= A515), M139 (≠ V565), Y154 (= Y580), K158 (= K584), P184 (= P610), G185 (≠ A612), F186 (≠ V613), V187 (≠ I614), T189 (≠ G616)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
33% identity, 37% coverage: 429:683/690 of query aligns to 6:240/251 of 6xewA
- active site: G16 (= G439), S138 (= S567), Y151 (= Y580)
- binding r,3-hydroxybutan-2-one: S138 (= S567), S140 (≠ N569), Y151 (= Y580)
- binding s,3-hydroxybutan-2-one: S138 (= S567), Y151 (= Y580), S182 (≠ D611)
- binding nicotinamide-adenine-dinucleotide: G12 (= G435), N15 (≠ G438), G16 (= G439), M17 (≠ I440), D36 (= D459), W37 (≠ I460), W37 (≠ I460), A38 (≠ D461), I59 (≠ A486), D60 (= D487), V61 (≠ I488), N87 (= N514), A88 (= A515), G89 (= G516), V110 (= V537), T136 (≠ V565), S138 (= S567), Y151 (= Y580), K155 (= K584), S182 (≠ D611), L183 (≠ A612), V184 (= V613), T186 (≠ S617), N187 (≠ R618), M188 (≠ I619), T189 (≠ W620)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
33% identity, 37% coverage: 429:683/690 of query aligns to 8:242/252 of 6vspB
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
33% identity, 37% coverage: 429:683/690 of query aligns to 6:240/251 of H9XP47
- N15 (≠ G438) binding
- M17 (≠ I440) binding
- D36 (= D459) binding
- D60 (= D487) binding
- V61 (≠ I488) binding
- N87 (= N514) binding
- S138 (= S567) binding ; binding
- V139 (≠ K568) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ N569) binding
- Y151 (= Y580) binding ; binding ; binding
- K155 (= K584) binding
- V184 (= V613) binding
- T186 (≠ S617) binding
- RDK 197:199 (≠ EEF 640:642) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
33% identity, 37% coverage: 429:683/690 of query aligns to 6:240/251 of 6vspA
- active site: G16 (= G439), S138 (= S567), Y151 (= Y580)
- binding nicotinamide-adenine-dinucleotide: G12 (= G435), N15 (≠ G438), G16 (= G439), M17 (≠ I440), D36 (= D459), W37 (≠ I460), W37 (≠ I460), A38 (≠ D461), I59 (≠ A486), D60 (= D487), V61 (≠ I488), N87 (= N514), A88 (= A515), G89 (= G516), V90 (≠ I517), V110 (= V537), T136 (≠ V565), S138 (= S567), Y151 (= Y580), K155 (= K584), P181 (= P610), S182 (≠ D611), L183 (≠ A612), V184 (= V613), T186 (≠ S617), N187 (≠ R618), M188 (≠ I619), T189 (≠ W620)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
34% identity, 37% coverage: 426:683/690 of query aligns to 6:249/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S567), I145 (≠ K568), E146 (≠ N569), Y157 (= Y580), V197 (≠ I619), F207 (≠ Y643)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G435), T17 (≠ G437), I20 (= I440), R40 (≠ I460), H41 (≠ D461), D64 (= D487), A65 (≠ I488), N91 (= N514), A92 (= A515), V114 (= V537), M142 (≠ V565), S144 (= S567), Y157 (= Y580), K161 (= K584), P189 (= P610), G190 (≠ A612), P191 (≠ V613), I192 (= I614), T194 (≠ G616), P195 (≠ S617), L196 (≠ R618)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
34% identity, 37% coverage: 426:683/690 of query aligns to 4:247/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S567), I143 (≠ K568), Y155 (= Y580), F205 (≠ Y643)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G435), T15 (≠ G437), L16 (≠ G438), G17 (= G439), I18 (= I440), R38 (≠ I460), H39 (≠ D461), D62 (= D487), A63 (≠ I488), N89 (= N514), A90 (= A515), V112 (= V537), M140 (≠ V565), S142 (= S567), Y155 (= Y580), K159 (= K584), P187 (= P610), P189 (≠ V613), I190 (= I614), T192 (≠ G616), P193 (≠ S617), L194 (≠ R618)
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
33% identity, 37% coverage: 426:683/690 of query aligns to 3:255/267 of F1SWA0
- S142 (= S567) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (≠ N569) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y580) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K584) mutation to A: Abolishes all oxidoreductase activity.
3m4rA Structure of the n-terminal class ii aldolase domain of a conserved protein from thermoplasma acidophilum
34% identity, 31% coverage: 5:220/690 of query aligns to 6:212/213 of 3m4rA
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
32% identity, 37% coverage: 424:676/690 of query aligns to 6:254/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G435), S20 (≠ G438), G21 (= G439), I22 (= I440), D41 (= D459), I42 (= I460), M66 (≠ R485), D67 (= D487), V68 (≠ I488), N94 (= N514), A95 (= A515), G96 (= G516), M145 (≠ V565), S147 (= S567), Y160 (= Y580), K164 (= K584), P190 (= P610), F192 (≠ A612), V193 (= V613), T195 (≠ S617), L197 (≠ I619), V198 (≠ W620)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ A518), S147 (= S567), H149 (≠ N569), K157 (≠ A577), Y160 (= Y580), F192 (≠ A612), Q201 (≠ K623)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
32% identity, 37% coverage: 424:676/690 of query aligns to 6:254/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ A518), H149 (≠ N569), K157 (≠ A577), F192 (≠ A612), Q201 (≠ K623)
- binding nicotinamide-adenine-dinucleotide: G17 (= G435), S20 (≠ G438), G21 (= G439), I22 (= I440), D41 (= D459), I42 (= I460), M66 (≠ R485), D67 (= D487), V68 (≠ I488), N94 (= N514), A95 (= A515), G96 (= G516), M145 (≠ V565), Y160 (= Y580), K164 (= K584), P190 (= P610), F192 (≠ A612), V193 (= V613), T195 (≠ S617), L197 (≠ I619), V198 (≠ W620)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
32% identity, 37% coverage: 426:683/690 of query aligns to 4:243/247 of 3rwbA
- active site: G17 (= G439), S140 (= S567), Y153 (= Y580), K157 (= K584)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S567), N141 (≠ K568), T142 (≠ N569), M150 (≠ A577), Y153 (= Y580), L185 (≠ A612), H196 (≠ V639)
- binding nicotinamide-adenine-dinucleotide: G13 (= G435), Q16 (≠ G438), G17 (= G439), I18 (= I440), D37 (= D459), I38 (= I460), D60 (= D487), I61 (= I488), N87 (= N514), A88 (= A515), S89 (≠ G516), I138 (≠ V565), S140 (= S567), Y153 (= Y580), K157 (= K584), P183 (= P610), L185 (≠ A612), I186 (≠ V613), S188 (= S631), G190 (≠ K633), V191 (≠ I634)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
32% identity, 37% coverage: 426:683/690 of query aligns to 4:243/247 of 3ndrA
- active site: G17 (= G439), S140 (= S567), Y153 (= Y580), K157 (= K584)
- binding nicotinamide-adenine-dinucleotide: G13 (= G435), Q16 (≠ G438), G17 (= G439), I18 (= I440), D37 (= D459), I38 (= I460), D60 (= D487), I61 (= I488), N87 (= N514), A88 (= A515), S89 (≠ G516), V110 (= V537), I138 (≠ V565), S140 (= S567), Y153 (= Y580), K157 (= K584), P183 (= P610), L185 (≠ A612), I186 (≠ V613), S188 (= S631), G190 (≠ K633), V191 (≠ I634)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
35% identity, 38% coverage: 426:688/690 of query aligns to 3:240/240 of 2d1yA
- active site: G16 (= G439), S135 (= S567), N145 (≠ A577), Y148 (= Y580), K152 (= K584)
- binding nicotinamide-adenine-dinucleotide: G12 (= G435), R15 (≠ G438), I17 (= I440), D36 (= D459), L37 (≠ I460), R38 (≠ D461), V55 (≠ A486), D56 (= D487), L57 (≠ I488), N83 (= N514), A84 (= A515), A85 (≠ G516), I86 (= I517), V133 (= V565), S135 (= S567), Y148 (= Y580), K152 (= K584), P178 (= P610), G179 (≠ D611), I181 (≠ V613), T183 (≠ E627), A185 (= A629), V186 (≠ A630)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
32% identity, 37% coverage: 426:683/690 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G439), N111 (≠ L538), S139 (= S567), Q149 (≠ A577), Y152 (= Y580), K156 (= K584)
- binding acetoacetyl-coenzyme a: D93 (≠ A520), K98 (≠ D525), S139 (= S567), N146 (≠ S574), V147 (≠ A575), Q149 (≠ A577), Y152 (= Y580), F184 (≠ A612), M189 (≠ A630), K200 (≠ E641)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G435), N17 (≠ G438), G18 (= G439), I19 (= I440), D38 (= D459), F39 (≠ I460), V59 (≠ A486), D60 (= D487), V61 (≠ I488), N87 (= N514), A88 (= A515), G89 (= G516), I90 (= I517), T137 (≠ V565), S139 (= S567), Y152 (= Y580), K156 (= K584), P182 (= P610), F184 (≠ A612), T185 (≠ V613), T187 (≠ R628), M189 (≠ A630)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
32% identity, 37% coverage: 426:683/690 of query aligns to 5:248/252 of Q6WVP7
Sites not aligning to the query:
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
34% identity, 37% coverage: 426:683/690 of query aligns to 5:254/258 of 3ak4A
- active site: G18 (= G439), S141 (= S567), L151 (≠ A577), Y154 (= Y580), K158 (= K584), E199 (≠ K625)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ G438), G18 (= G439), I19 (= I440), D38 (= D459), L39 (≠ I460), V60 (≠ A486), D61 (= D487), V62 (≠ I488), N88 (= N514), A89 (= A515), G90 (= G516), T139 (≠ V565), S141 (= S567), Y154 (= Y580), K158 (= K584), G185 (≠ D611), V187 (= V613), T189 (≠ R615), M191 (≠ S617)
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
37% identity, 34% coverage: 449:683/690 of query aligns to 28:251/255 of A7IQH5
- D38 (= D459) binding
- DV 64:65 (≠ DI 487:488) binding
- N91 (= N514) binding
- S143 (= S567) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y580) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K584) binding ; mutation to A: Loss of activity.
- T188 (≠ A612) binding
- V---TSTG 189:193 (≠ VIRGSRIW 613:620) binding
- R211 (≠ D638) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ E641) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ F642) binding
Sites not aligning to the query:
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
36% identity, 34% coverage: 449:683/690 of query aligns to 26:249/253 of 4ituA
- active site: N113 (≠ L538), S141 (= S567), Y154 (= Y580), K158 (= K584)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S567), Y154 (= Y580), T186 (≠ A612), R209 (≠ S647), Y213 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D36 (= D459), L37 (≠ I460), D62 (= D487), V63 (≠ I488), N89 (= N514), V112 (= V537), F139 (≠ V565), S141 (= S567), Y154 (= Y580), K158 (= K584), P184 (= P610), T186 (≠ A612), V187 (= V613), T190 (≠ R628), M192 (≠ A630)
Sites not aligning to the query:
Query Sequence
>HSERO_RS22235 FitnessBrowser__HerbieS:HSERO_RS22235
IASAWDEAYAATLDEPQLLLYRSNLLGADKEITNFGGGNTSAKIAMPDPLTGQTVEVLWV
KGSGGDLGSIKLDGFATLYMDKLEALRSRYRGLEHEDEMVGYLPHCTYNLNARAASIDTP
LHAYIPRRHVDHMHPDAVIAIAACKNSRDLTARIFEGELGWLPWQRPGYDLGLKLEQLVR
AQPHLKGIVLEGHGLFTWGDSARECYENTLNVIRRADAWLAANSRTPAFGGARYQALPKA
ERAALAARIMPLLRGKISKGEYKLGHFDDSQAVLDFVCSNDLAALAALGTSCPDHFLRTK
IRPLVLDFSPQQPDLAALEASLDAALEAYRQDYAAYYQRCARPNSPAMRDPNPVIYLIPG
VGMLSFAKDKATARIAGEFYINAVNVMRGANGVDSYVGLPEQEAFDIEYWLLEEAKLQRM
PKPKSLAGRIALVTGGGGGIGQAVARQLLAEGACVMLTDIDQSALDSAQQSLLKHGGPDA
IGVVRADITSEADVTTILNSVALRFGGIDLLVSNAGIASASPLQDTSLEVWQRNLSVLAT
GYFLVSRAAFSSMLTQGLGGSIVYVASKNGLVASAGASAYCTAKAAEIHLARCIALEGAP
HGIRVNVVNPDAVIRGSRIWDGKWKEERAASNKIEADDVEEFYRQRSMLKRSVLPEDIAE
AVYFFASEKSAKSTGNILNVDAGNAGAFTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory