SitesBLAST
Comparing HSERO_RS22255 FitnessBrowser__HerbieS:HSERO_RS22255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
42% identity, 94% coverage: 16:306/308 of query aligns to 9:302/304 of 1wwkA
- active site: S96 (≠ N103), R230 (= R234), D254 (= D258), E259 (= E263), H278 (= H282)
- binding nicotinamide-adenine-dinucleotide: V100 (= V107), G146 (= G153), F147 (≠ L154), G148 (= G155), R149 (≠ A156), I150 (= I157), Y168 (≠ H175), D169 (= D176), P170 (= P177), V201 (≠ C205), P202 (= P206), T207 (≠ N211), T228 (= T232), S229 (≠ A233), D254 (= D258), H278 (= H282), G280 (= G284)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
40% identity, 95% coverage: 9:302/308 of query aligns to 4:298/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
40% identity, 95% coverage: 9:302/308 of query aligns to 3:297/526 of 3dc2A
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 80% coverage: 60:305/308 of query aligns to 57:311/334 of 5aovA
- active site: L100 (≠ N103), R241 (= R234), D265 (= D258), E270 (= E263), H288 (= H282)
- binding glyoxylic acid: Y74 (≠ H77), A75 (≠ G78), V76 (≠ T79), G77 (= G80), R241 (= R234), H288 (= H282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T79), T104 (≠ V107), F158 (≠ L154), G159 (= G155), R160 (≠ A156), I161 (= I157), S180 (≠ D176), R181 (≠ P177), A211 (≠ H204), V212 (≠ C205), P213 (= P206), T218 (≠ N211), I239 (≠ T232), A240 (= A233), R241 (= R234), H288 (= H282), G290 (= G284)
Sites not aligning to the query:
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 36:290/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 36:290/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N103), A100 (≠ V107), R149 (≠ A156), I150 (= I157), Y168 (≠ H175), D169 (= D176), P170 (= P177), I171 (≠ Y178), H200 (= H204), T201 (≠ C205), P202 (= P206), T207 (≠ N211), C228 (≠ T232), A229 (= A233), R230 (= R234), H277 (= H282), G279 (= G284)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 34:288/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G155), I148 (= I157), Y166 (≠ H175), D167 (= D176), P168 (= P177), I169 (≠ Y178), I170 (≠ A179), H198 (= H204), T199 (≠ C205), L208 (≠ M214), R228 (= R234)
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 38:292/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T79), A102 (≠ V107), G148 (= G153), R151 (≠ A156), I152 (= I157), Y170 (≠ H175), D171 (= D176), P172 (= P177), I173 (≠ Y178), H202 (= H204), T203 (≠ C205), P204 (= P206), T209 (≠ N211), C230 (≠ T232), A231 (= A233), R232 (= R234), H279 (= H282), G281 (= G284)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 37:291/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V152), G147 (= G153), L148 (= L154), G149 (= G155), R150 (≠ A156), I151 (= I157), G152 (= G158), D170 (= D176), H201 (= H204), T202 (≠ C205), P203 (= P206)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 37:291/302 of 6rihA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 38:292/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 37:291/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 82% coverage: 44:295/308 of query aligns to 37:291/301 of 6rj5A
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
40% identity, 75% coverage: 71:302/308 of query aligns to 66:309/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T79), T102 (≠ V107), G155 (= G153), G157 (= G155), R158 (≠ A156), T159 (≠ I157), D178 (= D176), P179 (= P177), Y180 (= Y178), H210 (= H204), C211 (= C205), N212 (≠ P206), A238 (≠ T232), R240 (= R234), H289 (= H282), A291 (≠ G284), W292 (≠ G285)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
40% identity, 75% coverage: 71:302/308 of query aligns to 66:309/330 of 4lcjA
- active site: A98 (≠ N103), R240 (= R234), D264 (= D258), E269 (= E263), H289 (= H282)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: I72 (≠ H77), G73 (= G78), S74 (≠ T79), G75 (= G80), R240 (= R234), H289 (= H282), W292 (≠ G285)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T79), T102 (≠ V107), I154 (≠ V152), G155 (= G153), G157 (= G155), R158 (≠ A156), T159 (≠ I157), D178 (= D176), Y180 (= Y178), H210 (= H204), C211 (= C205), N212 (≠ P206), N214 (≠ T208), N217 (= N211), A238 (≠ T232), A239 (= A233), R240 (= R234), H289 (= H282), W292 (≠ G285)
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 82% coverage: 44:295/308 of query aligns to 42:296/533 of O43175
- T78 (= T79) binding
- R135 (≠ K136) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ AI 156:157) binding
- D175 (= D176) binding
- T207 (≠ C205) binding
- CAR 234:236 (≠ TAR 232:234) binding
- D260 (= D258) binding
- V261 (≠ S259) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGG 282:285) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 85% coverage: 33:295/308 of query aligns to 21:282/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ A156), Y160 (≠ H175), D161 (= D176), P162 (= P177), I164 (≠ A179), L179 (= L191), T193 (≠ C205), P194 (= P206), S198 (≠ E210), L202 (≠ M214)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
39% identity, 75% coverage: 71:302/308 of query aligns to 67:310/331 of 1hl3A
- active site: S99 (≠ N103), R241 (= R234), D265 (= D258), E270 (= E263), H290 (= H282)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V107), G158 (= G155), R159 (≠ A156), V160 (≠ I157), D179 (= D176), Y181 (= Y178), H211 (= H204), C212 (= C205), G213 (≠ P206), N218 (= N211), T239 (= T232), A240 (= A233), R241 (= R234), D265 (= D258), H290 (= H282)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
39% identity, 75% coverage: 71:302/308 of query aligns to 67:310/331 of 1hkuA
- active site: S99 (≠ N103), R241 (= R234), D265 (= D258), E270 (= E263), H290 (= H282)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ T79), T103 (≠ V107), G156 (= G153), G158 (= G155), R159 (≠ A156), V160 (≠ I157), Y178 (≠ H175), D179 (= D176), P180 (= P177), Y181 (= Y178), C212 (= C205), N218 (= N211), T239 (= T232), A240 (= A233), R241 (= R234), H290 (= H282), W293 (≠ G285)
Sites not aligning to the query:
4lceA Ctbp1 in complex with substrate mtob (see paper)
39% identity, 75% coverage: 71:302/308 of query aligns to 66:309/327 of 4lceA
- active site: S98 (≠ N103), R240 (= R234), D264 (= D258), E269 (= E263), H289 (= H282)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (≠ K76), G73 (= G78), S74 (≠ T79), G75 (= G80), R240 (= R234), H289 (= H282), W292 (≠ G285)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T79), T102 (≠ V107), G155 (= G153), G157 (= G155), R158 (≠ A156), V159 (≠ I157), Y177 (≠ H175), D178 (= D176), P179 (= P177), Y180 (= Y178), H210 (= H204), C211 (= C205), N214 (≠ T208), N217 (= N211), T238 (= T232), A239 (= A233), R240 (= R234), W292 (≠ G285)
Query Sequence
>HSERO_RS22255 FitnessBrowser__HerbieS:HSERO_RS22255
VSAAKKEVVIVTGVDLAQAAVELLRDYELVYAGAKPTEDDMVKLAQLHQPVAIIVRYGGV
SARVMDAAPILRVISKHGTGIDSIDSQAAQQRGIAVKAAAGANAPAVAEHTWALIMACAK
NVVGLDQRMREGHWDKSTHKSLELQGRTLGLVGLGAIGRRVAAVAAALGMPVLAHDPYAK
EAPQGVQLVDLDTLFAQSDVVSLHCPLTAENKHMINAQSLARMKDGAILVNTARGGLIDE
QALIAALDSGKLRAAGLDSFEKEPFTAPHPLQRVGNAVLSPHIGGVTSDAYIAMGTGAAS
NVLAVLGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory