SitesBLAST
Comparing HSERO_RS22270 FitnessBrowser__HerbieS:HSERO_RS22270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 92% coverage: 21:431/445 of query aligns to 61:496/582 of Q9JI12
- R88 (= R46) mutation to A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- H128 (≠ A71) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R125) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E132) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ G267) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
22% identity, 92% coverage: 21:431/445 of query aligns to 3:438/452 of 7t3nA
- binding (1s,3r)-1-aminocyclopentane-1,3-dicarboxylic acid: Y77 (= Y78), Y137 (≠ T136), Y165 (≠ P164), R264 (≠ G267), F268 (≠ S271), Y269 (≠ L272)
- binding (2R)-2-(methoxymethyl)-4-{[(25R)-spirost-5-en-3beta-yl]oxy}butyl 4-O-alpha-D-glucopyranosyl-beta-D-glucopyranoside: R12 (= R30), Y13 (≠ L31), E152 (≠ W151), G163 (= G162)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 70% coverage: 25:337/445 of query aligns to 82:399/534 of P53322
- K283 (≠ A223) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
21% identity, 91% coverage: 35:437/445 of query aligns to 21:429/430 of P0AA76
- Y29 (= Y43) binding
- D31 (= D45) mutation to N: Loss of galactonate transport activity.
- R32 (= R46) binding
- Y64 (= Y78) binding
- E118 (= E132) mutation to Q: Loss of galactonate transport activity.
- W358 (= W366) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
21% identity, 90% coverage: 35:436/445 of query aligns to 10:409/409 of 6e9nA
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
23% identity, 67% coverage: 20:315/445 of query aligns to 2:332/493 of Q03567
- N69 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
21% identity, 90% coverage: 35:436/445 of query aligns to 13:393/393 of 6e9oA
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
22% identity, 58% coverage: 72:328/445 of query aligns to 113:373/495 of Q9NRA2
- K136 (≠ R95) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ Y140) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AT 155:156) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- I---L 266:267 (≠ LENEL 229:233) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ STEQN 234:238) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G293) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P299) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (= G326) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
21% identity, 49% coverage: 34:253/445 of query aligns to 99:330/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
22% identity, 58% coverage: 72:328/445 of query aligns to 113:373/495 of Q8BN82
- H183 (≠ Y140) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
22% identity, 78% coverage: 90:438/445 of query aligns to 82:441/452 of Q5EXK5
- D82 (≠ H90) mutation to A: Loss of activity.
- V311 (≠ R312) mutation to W: Loss of activity.
- D314 (≠ N315) mutation to A: Loss of activity.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 38% coverage: 72:239/445 of query aligns to 113:280/495 of Q5Q0U0
- K136 (≠ R95) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R125) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L128) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G129) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E132) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A133) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ T136) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P137) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ Y140) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ F143) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ --LEN 229:231) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 334 P→R: Abolishes H(+)-coupled sialic acid transporter activity.
- 371 G→V: Remains in the endoplasmic reticulum.
Query Sequence
>HSERO_RS22270 FitnessBrowser__HerbieS:HSERO_RS22270
MSQASISPAASAVATAAVSEDATMKKVMRRLIPFILLCYVVSYLDRINVGFAALTMNKDL
GLTPSQFGLGAGLFFIGYFFFEIPSNLALHRFGARMWISRIMISWGLISMATAFVVGPKS
FALARFLLGMAEAGFTPGIYLYFTQWFPGAWRGKATAFFLIGIPVANIIGSPLSGALMEL
HGMWGFKGWQVLLLLEALPAVLLGVMCLFLLPDRPAKAKWLSADEKQWLENELSTEQNVL
AARHGNKLKDAFTNWRVFALAGANFCGIIGSLSIGLWLPQIIREFGLPSHQVGLVAAIPY
LVGAVAMTLWARLANRSERRLFFVAGAIVLAALSLGISAFLHTPLLKMLAITVAVASILS
FQATFWAIPSGFLTGRAAAGGLALIVSIGNLGGFVGPSVIGFIREATQGFTYPLIFVAGA
LLLGAVITLALGDPSRVPPTSKETA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory