SitesBLAST
Comparing HSERO_RS22390 FitnessBrowser__HerbieS:HSERO_RS22390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
46% identity, 90% coverage: 45:462/466 of query aligns to 22:441/478 of Q47945
- Q37 (≠ A60) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
47% identity, 86% coverage: 62:462/466 of query aligns to 1:403/433 of 8gy2B
- binding heme c: C18 (= C79), C21 (= C82), H22 (= H83), T46 (= T107), I48 (= I109), Y59 (≠ W120), L68 (≠ M129), R73 (≠ T134), V79 (= V140), Y80 (= Y141), M83 (= M144), F88 (≠ Y149), R126 (= R187), H165 (= H226), C166 (= C227), C169 (= C230), H170 (= H231), I201 (≠ S262), A202 (≠ V263), P203 (= P264), L205 (= L266), W216 (= W277), F224 (= F285), A234 (= A295), V235 (≠ S296), F236 (= F297), F236 (= F297), M239 (= M300), N301 (≠ R361), C302 (= C362), C305 (= C365), H306 (= H366), M316 (≠ A376), F317 (= F377), P318 (= P378), L320 (= L380), P324 (= P384), G342 (= G402), S352 (≠ A412), V354 (≠ L414), M356 (= M416), F359 (≠ Y419), M375 (≠ I435)
- binding ubiquinone-10: C21 (= C82), L34 (= L95), P39 (= P100), P81 (= P142), L129 (= L190), W132 (= W193), E168 (≠ S229), R173 (= R234), I197 (≠ V258), D241 (= D302)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 86% coverage: 67:465/466 of query aligns to 1:398/418 of 7w2jC
- binding heme c: C13 (= C79), C16 (= C82), H17 (= H83), T42 (= T107), I44 (= I109), Y55 (≠ W120), L75 (≠ V140), Y76 (= Y141), A78 (= A143), M79 (= M144), R122 (= R187), H161 (= H226), C162 (= C227), C165 (= C230), H166 (= H231), A191 (≠ V263), P192 (= P264), R223 (≠ A295), P227 (≠ A299), M228 (= M300), V289 (≠ R361), C290 (= C362), C293 (= C365), H294 (= H366), Y305 (vs. gap), Y306 (≠ F377), P307 (= P378), L309 (= L380), N312 (= N383), T313 (≠ P384), T314 (≠ V385), D322 (≠ S393), I327 (= I398), V331 (≠ G402), R333 (≠ Q404), I340 (≠ T411), M342 (≠ G413), P343 (≠ L414), F345 (≠ M416)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
35% identity, 86% coverage: 67:465/466 of query aligns to 1:412/413 of 8jejC
- binding heme c: C13 (= C79), C16 (= C82), H17 (= H83), T42 (= T107), I44 (= I109), F60 (= F125), L64 (≠ M129), L75 (≠ V140), Y76 (= Y141), M79 (= M144), P80 (= P145), Y84 (= Y149), R122 (= R187), C162 (= C227), C165 (= C230), H166 (= H231), I186 (≠ V258), W189 (= W261), A191 (≠ V263), P192 (= P264), I194 (≠ L266), W205 (= W277), Y213 (≠ F285), R223 (≠ A295), M228 (= M300), V303 (≠ R361), C304 (= C362), C307 (= C365), H308 (= H366), Y320 (≠ F377), P321 (= P378), L323 (= L380), T327 (≠ P384), T328 (≠ V385), D336 (≠ S393), I341 (= I398), V345 (≠ G402), R347 (≠ Q404), I354 (≠ T411), M356 (≠ G413), F359 (≠ M416), I376 (≠ V431)
- binding ubiquinone-10: M36 (≠ I101), P77 (= P142), S124 (≠ P189), W128 (= W193), C165 (= C230), L173 (≠ M238), L408 (≠ V461), L411 (≠ R464)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
31% identity, 79% coverage: 67:436/466 of query aligns to 41:408/440 of 8gy3A
- binding heme c: Y52 (≠ D78), C53 (= C79), C56 (= C82), H57 (= H83), S84 (≠ T107), I86 (= I109), W97 (= W120), F102 (= F125), L117 (≠ V140), F121 (≠ M144), F126 (≠ Y149), R163 (= R187), C203 (= C227), C206 (= C230), H207 (= H231), A232 (≠ V263), P233 (= P264), L235 (= L266), W245 (= W277), Y253 (≠ F285), L254 (= L286), G263 (≠ T294), S264 (≠ A295), M269 (= M300), Y292 (≠ L323), C337 (= C362), C340 (= C365), H341 (= H366), P353 (= P378), L355 (= L380), N358 (= N383), N359 (≠ P384), V372 (≠ I397), I377 (≠ P405), G382 (≠ A410), Q383 (≠ T411), I386 (≠ L414), M388 (= M416), F391 (≠ Y419)
- binding ubiquinone-10: E55 (≠ A81), T76 (≠ S99), F78 (≠ I101), Y118 (= Y141), P119 (= P142), I160 (≠ L184), G166 (vs. gap), Q167 (≠ L190), F169 (≠ L192), W170 (= W193), H202 (= H226), R210 (= R234), L213 (≠ T237)
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
35% identity, 22% coverage: 354:455/466 of query aligns to 353:453/456 of 5oboA
- binding heme c: T360 (≠ R361), C361 (= C362), C364 (= C365), H365 (= H366), P377 (= P378), P378 (≠ A379), L379 (= L380), S382 (≠ N383), F384 (≠ V385), I395 (= I397), N401 (≠ G402), G402 (≠ R403), S413 (≠ L414), M415 (= M416), M418 (≠ Y419)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
35% identity, 22% coverage: 354:455/466 of query aligns to 352:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ R361), C360 (= C362), C363 (= C365), H364 (= H366), P376 (= P378), P377 (≠ A379), L378 (= L380), F383 (≠ V385), N400 (≠ G402), G401 (≠ R403), Y410 (≠ A412), S412 (≠ L414), M414 (= M416), M417 (≠ Y419)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
35% identity, 22% coverage: 354:455/466 of query aligns to 355:455/457 of 4ax3D
- binding heme c: C363 (= C362), C366 (= C365), H367 (= H366), P379 (= P378), P380 (≠ A379), L381 (= L380), S384 (≠ N383), F386 (≠ V385), N403 (≠ G402), G404 (≠ R403), S415 (≠ L414), M417 (= M416), M420 (≠ Y419)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
33% identity, 22% coverage: 354:455/466 of query aligns to 339:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C362), C350 (= C365), H351 (= H366), F362 (= F377), P363 (= P378), P364 (≠ A379), L365 (= L380), S368 (≠ N383), Y370 (≠ V385), I382 (= I398), L386 (≠ G402), S387 (≠ R403), G388 (≠ Q404), I390 (≠ S406), V392 (≠ A408), Y397 (≠ G413), N398 (≠ L414), G399 (≠ V415), V400 (≠ M416), M401 (≠ A417)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
33% identity, 22% coverage: 355:455/466 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C362), C33 (= C365), H34 (= H366), Y46 (vs. gap), P47 (= P378), T54 (≠ V385), V66 (≠ I397), I67 (= I398), R73 (≠ P405), I80 (≠ A412), M82 (= M416), P83 (≠ A417)
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
36% identity, 22% coverage: 354:455/466 of query aligns to 2:110/129 of 1dt1A
- binding heme c: C9 (= C362), C12 (= C365), H13 (= H366), P25 (= P378), H30 (≠ N383), Y43 (≠ A394), V47 (≠ I398), Q53 (= Q404), G54 (≠ P405), G65 (≠ L414), M67 (= M416), F70 (≠ Y419)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
36% identity, 22% coverage: 354:455/466 of query aligns to 3:111/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C365), H14 (= H366), P26 (= P378), L28 (= L380), H31 (≠ N383), Y44 (≠ A394), V48 (≠ I398), Q54 (= Q404), G55 (≠ P405), G66 (≠ L414), M68 (= M416)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
36% identity, 22% coverage: 354:455/466 of query aligns to 3:111/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y358), C10 (= C362), C13 (= C365), H14 (= H366), P26 (= P378), H31 (≠ N383), Y44 (≠ A394), Q54 (= Q404), G55 (≠ P405), G66 (≠ L414), M68 (= M416), F71 (≠ Y419)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
36% identity, 22% coverage: 354:455/466 of query aligns to 4:112/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C362), C14 (= C365), H15 (= H366), F26 (= F377), P27 (= P378), L29 (= L380), H32 (≠ N383), Y45 (≠ A394), L54 (≠ R403), Q55 (= Q404), G56 (≠ P405), G67 (≠ L414), M69 (= M416), F72 (≠ Y419)
Sites not aligning to the query:
Query Sequence
>HSERO_RS22390 FitnessBrowser__HerbieS:HSERO_RS22390
LAGAAAFPLALAEPSLSVPIPPQPPVGARLLNREIKPLRPHATPAADTALAQRIAAQGSA
SAEDQQILRGAYLARAGDCVACHTSKGGAPFAGGLALASPIGAIYSTNITPDKQHGIGDW
SYEDFARLMRTGVTKAGYTVYPAMPYPSYSRLTDEDMQALYAYFSKAVPPSAQENRANDI
PWPLSMRWPLALWRKVFAPTPAPYTPAAGSDQELARGAYLVEGLGHCGSCHSPRAVTMQE
KALKEDGGRLFLSGGQVVDGWSVPSLRNEHGGGIAGWSQADLVEFLRTGRNQYTASFGAM
NDVIEDSMQYMSDADLNAMARYLLSLPPRQQAAPYRYDSATAQAAYDGRPDGPGARIYLD
RCAACHRSNGTGYGKAFPALAGNPVLQTSDATSAIRIILQGGRQPSTASATAGLVMAPYA
QLLDDQQVAEVTSYIQTAWGNRGGTTTAAEVAKVRKTAVPVAERAP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory