SitesBLAST
Comparing HSERO_RS22475 FitnessBrowser__HerbieS:HSERO_RS22475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
48% identity, 95% coverage: 12:261/263 of query aligns to 4:254/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G26), T21 (≠ S29), I23 (= I31), D42 (= D50), I43 (= I51), C68 (= C75), D69 (≠ N76), L70 (= L77), N96 (= N103), A98 (= A105), F146 (= F153), S147 (≠ G154), S148 (= S155), Y161 (= Y168), K165 (= K172), P191 (= P198), G192 (= G199), W193 (≠ A200), V194 (≠ I201), R198 (= R205)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
45% identity, 95% coverage: 10:260/263 of query aligns to 7:257/258 of 5wjsA
- active site: G27 (= G30), S152 (= S155), Y162 (≠ L165), Y165 (= Y168), K169 (= K172)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G26), T26 (≠ S29), I28 (= I31), D47 (= D50), L48 (≠ I51), D73 (≠ N76), L74 (= L77), N100 (= N103), A102 (= A105), L150 (≠ F153), G151 (= G154), S152 (= S155), K169 (= K172), P195 (= P198), G196 (= G199), W197 (≠ A200), V198 (≠ I201), K202 (≠ R205)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
34% identity, 93% coverage: 17:261/263 of query aligns to 6:246/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G26), R18 (≠ S29), G19 (= G30), I20 (= I31), D39 (= D50), R40 (≠ I51), C63 (= C75), I65 (≠ L77), N91 (= N103), G93 (≠ A105), I94 (≠ N106), V114 (= V126), Y155 (= Y168), K159 (= K172), I188 (= I201), T190 (= T203), T193 (≠ L209)
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
33% identity, 83% coverage: 42:260/263 of query aligns to 30:252/255 of A7IQH5
- D38 (= D50) binding
- DV 64:65 (≠ NL 76:77) binding
- N91 (= N103) binding
- S143 (= S155) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y168) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K172) binding ; mutation to A: Loss of activity.
- T188 (≠ A200) binding
- VTSTG 189:193 (≠ IRTP- 201:204) binding
- R211 (≠ I219) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ A222) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ Q223) binding
Sites not aligning to the query:
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
33% identity, 83% coverage: 42:260/263 of query aligns to 28:250/253 of 4ituA
- active site: N113 (= N127), S141 (= S155), Y154 (= Y168), K158 (= K172)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S155), Y154 (= Y168), T186 (≠ A200), R209 (≠ I219), Y213 (≠ Q223)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D36 (= D50), L37 (≠ I51), D62 (≠ N76), V63 (≠ L77), N89 (= N103), V112 (= V126), F139 (= F153), S141 (= S155), Y154 (= Y168), K158 (= K172), P184 (= P198), T186 (≠ A200), V187 (≠ I201), T190 (≠ P204), M192 (vs. gap)
Sites not aligning to the query:
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 90% coverage: 23:259/263 of query aligns to 8:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G26), M16 (≠ I31), D35 (= D50), I36 (= I51), I62 (≠ L77), N88 (= N103), G90 (≠ A105), I138 (≠ F153), S140 (= S155), Y152 (= Y168), K156 (= K172), I185 (= I201)
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
33% identity, 83% coverage: 42:260/263 of query aligns to 28:245/248 of 4gh5A
- active site: N113 (= N127), S141 (= S155), Y154 (= Y168), K158 (= K172)
- binding nicotinamide-adenine-dinucleotide: D36 (= D50), L37 (≠ I51), A61 (≠ C75), D62 (≠ N76), V63 (≠ L77), N89 (= N103), A90 (= A104), V112 (= V126), F139 (= F153), S141 (= S155), Y154 (= Y168), K158 (= K172), P184 (= P198), V187 (≠ I201), T190 (≠ P204), G191 (vs. gap), M192 (vs. gap)
Sites not aligning to the query:
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 90% coverage: 23:259/263 of query aligns to 9:242/248 of Q9KJF1
- S15 (= S29) binding
- D36 (= D50) binding
- D62 (≠ N76) binding
- I63 (≠ L77) binding
- N89 (= N103) binding
- Y153 (= Y168) binding
- K157 (= K172) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
33% identity, 94% coverage: 14:260/263 of query aligns to 3:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G26), S17 (≠ G28), R18 (≠ S29), I20 (= I31), T40 (≠ I51), N62 (= N76), V63 (≠ L77), N89 (= N103), A90 (= A104), I92 (≠ N106), V139 (≠ F153), S141 (= S155), Y154 (= Y168), K158 (= K172), P184 (= P198), G185 (= G199), I187 (= I201), T189 (= T203), M191 (≠ R205)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 93% coverage: 17:261/263 of query aligns to 3:242/244 of 7krmC
- active site: G18 (= G30), S140 (= S155), Y155 (= Y168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G26), S15 (= S29), G18 (= G30), I19 (= I31), D38 (= D50), L39 (≠ I51), A60 (≠ C75), N61 (= N76), V62 (≠ L77), N88 (= N103), V111 (= V126), S140 (= S155), Y155 (= Y168), K159 (= K172), I188 (= I201), T190 (= T203)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
31% identity, 94% coverage: 16:261/263 of query aligns to 8:247/254 of 3o03A
- active site: G22 (= G30), S147 (= S155), V157 (≠ L165), Y160 (= Y168), K164 (= K172)
- binding calcium ion: S147 (= S155), M148 (≠ I156), P190 (= P198)
- binding D-gluconic acid: I99 (≠ D107), R101 (= R109), S147 (= S155), M149 (≠ S157), R154 (≠ L162), Y160 (= Y168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G26), Y21 (≠ S29), G22 (= G30), I23 (= I31), D42 (= D50), I43 (= I51), L47 (≠ P55), D68 (≠ N76), V69 (≠ L77), N95 (= N103), A96 (= A104), G97 (≠ A105), I145 (≠ F153), Y160 (= Y168), K164 (= K172), P190 (= P198)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
32% identity, 94% coverage: 14:260/263 of query aligns to 3:240/243 of 4i08A
- active site: G19 (= G30), N113 (= N127), S141 (= S155), Q151 (≠ L165), Y154 (= Y168), K158 (= K172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G26), S17 (≠ G28), R18 (≠ S29), I20 (= I31), T40 (≠ I51), N62 (= N76), V63 (≠ L77), N89 (= N103), A90 (= A104), G140 (= G154), S141 (= S155), Y154 (= Y168), K158 (= K172), P184 (= P198), G185 (= G199), T189 (= T203)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
33% identity, 92% coverage: 17:259/263 of query aligns to 3:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G26), Q15 (≠ S29), G16 (= G30), I17 (= I31), D36 (= D50), V63 (≠ L77), N89 (= N103), A91 (= A105), S94 (≠ D108), I142 (≠ F153), S143 (≠ G154), S144 (= S155), Y157 (= Y168), K161 (= K172), P187 (= P198), H188 (≠ G199), I190 (= I201), I194 (vs. gap)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 94% coverage: 13:260/263 of query aligns to 1:252/255 of 5itvA
- active site: G18 (= G30), S141 (= S155), Y154 (= Y168), K158 (= K172)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G26), S17 (= S29), G18 (= G30), I19 (= I31), D38 (= D50), I39 (= I51), T61 (≠ C75), I63 (≠ L77), N89 (= N103), G91 (≠ A105), T139 (≠ F153), S141 (= S155), Y154 (= Y168), K158 (= K172), P184 (= P198), G185 (= G199), I186 (≠ A200), I187 (= I201)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
31% identity, 94% coverage: 13:260/263 of query aligns to 1:258/261 of 6zzsD
- active site: G18 (= G30), S143 (= S155), Y156 (= Y168)
- binding nicotinamide-adenine-dinucleotide: G14 (= G26), S17 (= S29), I19 (= I31), D38 (= D50), M39 (≠ I51), D64 (≠ N76), V65 (≠ L77), N91 (= N103), A92 (= A104), G93 (≠ A105), M141 (≠ F153), A142 (≠ G154), S143 (= S155), Y156 (= Y168), K160 (= K172), P186 (= P198), G187 (= G199), V189 (≠ I201), T191 (= T203), L193 (vs. gap)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ D107), S143 (= S155), N145 (≠ S157), K153 (≠ L165), Y156 (= Y168), Q197 (vs. gap)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
36% identity, 92% coverage: 20:261/263 of query aligns to 1:250/253 of 4nbwA
- active site: G12 (= G30), S146 (= S155), Y159 (= Y168), K163 (= K172)
- binding nicotinamide-adenine-dinucleotide: G8 (= G26), N11 (≠ S29), G12 (= G30), I13 (= I31), D32 (= D50), L33 (≠ I51), V57 (≠ C75), D58 (≠ N76), V59 (≠ L77), N85 (= N103), A86 (= A104), G87 (≠ A105), S146 (= S155), Y159 (= Y168), K163 (= K172), I192 (= I201), T194 (= T203)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
31% identity, 94% coverage: 15:260/263 of query aligns to 2:257/260 of 6zzqA
- active site: G17 (= G30), S142 (= S155), Y155 (= Y168)
- binding acetoacetic acid: Q94 (≠ D107), S142 (= S155), K152 (≠ L165), Y155 (= Y168), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G26), S16 (= S29), G17 (= G30), I18 (= I31), D37 (= D50), M38 (≠ I51), D63 (≠ N76), V64 (≠ L77), N90 (= N103), A91 (= A104), G92 (≠ A105), M140 (≠ F153), A141 (≠ G154), S142 (= S155), Y155 (= Y168), K159 (= K172), Y187 (≠ A200), V188 (≠ I201), T190 (= T203)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
31% identity, 93% coverage: 17:261/263 of query aligns to 5:243/244 of 4nbuB
- active site: G18 (= G30), N111 (= N127), S139 (= S155), Q149 (≠ L165), Y152 (= Y168), K156 (= K172)
- binding acetoacetyl-coenzyme a: D93 (≠ R109), K98 (≠ D114), S139 (= S155), N146 (≠ L162), V147 (≠ P163), Q149 (≠ L165), Y152 (= Y168), F184 (≠ A200), M189 (≠ L208), K200 (≠ I219)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G26), N17 (≠ S29), G18 (= G30), I19 (= I31), D38 (= D50), F39 (≠ I51), V59 (≠ C75), D60 (≠ N76), V61 (≠ L77), N87 (= N103), A88 (= A104), G89 (≠ A105), I90 (≠ N106), T137 (≠ F153), S139 (= S155), Y152 (= Y168), K156 (= K172), P182 (= P198), F184 (≠ A200), T185 (≠ I201), T187 (= T203), M189 (≠ L208)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
30% identity, 94% coverage: 13:259/263 of query aligns to 1:245/249 of Q5P5I4
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
31% identity, 93% coverage: 15:259/263 of query aligns to 1:243/247 of 2ewmB
- active site: G16 (= G30), S139 (= S155), Y149 (≠ L165), Y152 (= Y168), K156 (= K172)
- binding nicotinamide-adenine-dinucleotide: G12 (= G26), N15 (≠ S29), G16 (= G30), I17 (= I31), D36 (= D50), L37 (≠ I51), C59 (= C75), D60 (≠ N76), V61 (≠ L77), N87 (= N103), S139 (= S155), Y152 (= Y168), K156 (= K172), P182 (= P198), S183 (≠ G199), L184 (≠ A200), V185 (≠ I201), T189 (≠ E214)
Query Sequence
>HSERO_RS22475 FitnessBrowser__HerbieS:HSERO_RS22475
MTAATTPAFEHALYRSLAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIAAEPSQALV
ASLKDAPIAPRFFPCNLMNLEALRATFTEIETVMGGVDILINNAANDDRHKTADVTPAYW
DERLAVNLRHQFFCAQAVLPGMRERKQGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTH
GMARDFGRDGVRVNAIIPGAIRTPRQTLLWHTPEEEAKILAAQCLPTRVDPHDVAALALF
LSSDSGAKCTGREYYVDAGWLGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory