Comparing HSERO_RS22660 FitnessBrowser__HerbieS:HSERO_RS22660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7ndrD Crystal structure of tphc in an open conformation (see paper)
24% identity, 89% coverage: 26:311/320 of query aligns to 6:286/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
24% identity, 89% coverage: 26:311/320 of query aligns to 6:286/294 of 7ndsA
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
25% identity, 87% coverage: 24:302/320 of query aligns to 4:277/302 of 8hkbA
2dvzA Structure of a periplasmic transporter (see paper)
24% identity, 69% coverage: 24:245/320 of query aligns to 6:223/300 of 2dvzA
Sites not aligning to the query:
2f5xB Structure of periplasmic binding protein bugd (see paper)
25% identity, 52% coverage: 114:279/320 of query aligns to 94:256/300 of 2f5xB
Sites not aligning to the query:
>HSERO_RS22660 FitnessBrowser__HerbieS:HSERO_RS22660
MLASRWRSLLAACLLACLGPCALAAECIVPAKPGGGMDASCKLLQRVMQEEGEPRSLKLS
YLPGGIGAVAWSSVVSQRRGGPDTLVAFSGGSLLGLAQGKYGKAVPDDVRWVAGIGIDHG
MIAVRSDAPWRNLKQLLQAIRRDPSAVTIGLSGTVGSQDWLKMALLGQRAGIVPRQFRFV
ALEGGGDSFAALQAGHVQVISGDASEAAYFMAEGKVRVLAVLSEQRLPGPLQAVPTAREQ
GYEVVWPIIRGFYMSPHVPEADYQRWVRYFDRMMADPVFLAQRSTSGLQPFAMTGSQLSQ
YINQTVTQYRKQSQELGLVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory