SitesBLAST
Comparing HSERO_RS22690 FitnessBrowser__HerbieS:HSERO_RS22690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
25% identity, 90% coverage: 11:409/444 of query aligns to 15:421/425 of O59010
- S65 (≠ V55) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ T269) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ TSS 269:271) binding
- M311 (≠ L304) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ F307) binding
- V355 (= V348) binding
- D394 (≠ G382) binding
- M395 (≠ I383) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R385) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N389) binding
- D405 (≠ N393) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
25% identity, 89% coverage: 11:404/444 of query aligns to 6:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
25% identity, 89% coverage: 11:404/444 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G59), V83 (≠ I77), I157 (≠ T161), Y164 (≠ L168), K193 (= K189), T305 (≠ S301), I306 (≠ F302), I347 (≠ K343)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V12), M199 (≠ I195), S275 (= S271), T311 (≠ F307), G356 (≠ A352), L384 (= L375), D391 (≠ G382), R394 (= R385)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
25% identity, 89% coverage: 11:404/444 of query aligns to 15:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L36), F46 (≠ L36), P75 (≠ D65), L91 (≠ V82), F95 (≠ I86), L130 (≠ F131), I133 (≠ F134), I159 (≠ V160), Y167 (≠ L168), K196 (= K189), G200 (≠ F193), I207 (≠ L200), F210 (≠ L203), L250 (≠ I243), I262 (= I255), M269 (≠ L262), T334 (≠ S327), V335 (≠ M328), G336 (= G329), T340 (≠ A333), L343 (≠ A336), M399 (≠ L387)
- binding aspartic acid: S277 (= S270), S278 (= S271), T314 (≠ F307), G354 (= G347), A358 (≠ S351), G359 (≠ A352), D394 (≠ G382), R397 (= R385), T398 (≠ A386)
- binding sodium ion: Y89 (≠ F80), T92 (≠ V83), S93 (≠ T84), G306 (= G299), T308 (≠ S301), N310 (= N303), N310 (= N303), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), T352 (≠ A345), N401 (= N389), V402 (≠ L390), D405 (≠ N393)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
25% identity, 92% coverage: 4:411/444 of query aligns to 11:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
25% identity, 92% coverage: 4:411/444 of query aligns to 11:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ T269), S275 (= S270), S276 (= S271), T313 (≠ F307), G353 (= G347), V354 (= V348), A357 (≠ S351), G358 (≠ A352), D394 (≠ G382), R397 (= R385), T398 (≠ A386)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K189), G198 (≠ F193), Y202 (≠ L197)
- binding sodium ion: Y87 (≠ F80), T90 (≠ V83), S91 (≠ T84), S276 (= S271), G305 (= G299), A306 (≠ Y300), T307 (≠ S301), N309 (= N303), N309 (= N303), M310 (≠ L304), D311 (= D305), S348 (= S342), I349 (≠ K343), G350 (= G344), T351 (≠ A345), N401 (= N389), V402 (≠ L390), D405 (≠ N393)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
25% identity, 92% coverage: 4:411/444 of query aligns to 8:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K189), G195 (≠ F193), R282 (≠ K280)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ T269), S272 (= S270), S273 (= S271), M307 (≠ L304), T310 (≠ F307), G353 (= G350), A354 (≠ S351), R394 (= R385), T395 (≠ A386)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
25% identity, 92% coverage: 4:411/444 of query aligns to 9:421/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
26% identity, 92% coverage: 4:411/444 of query aligns to 4:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ T269), S265 (= S271), M299 (≠ L304), T302 (≠ F307), T340 (≠ A345), G342 (= G347), V343 (= V348), G347 (≠ A352), D383 (≠ G382), R386 (= R385), T387 (≠ A386), N390 (= N389)
- binding decyl-beta-d-maltopyranoside: H23 (≠ D28), V212 (≠ L218), A216 (= A222)
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
25% identity, 89% coverage: 11:404/444 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S271), M303 (≠ L304), T306 (≠ F307), A345 (≠ H346), G346 (= G347), V347 (= V348), G351 (≠ A352), D386 (≠ G382), C389 (≠ R385), T390 (≠ A386), N393 (= N389)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
25% identity, 89% coverage: 11:404/444 of query aligns to 7:408/409 of 6bavA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 85% coverage: 37:413/444 of query aligns to 57:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V69), G89 (= G70), G92 (= G73), A95 (= A76), V96 (≠ I77), Y99 (≠ F80), M163 (≠ V160), F167 (≠ C164), F293 (≠ L294), V297 (≠ T298)
- binding aspartic acid: S268 (= S270), S269 (= S271), T306 (≠ F307), G346 (= G347), I347 (≠ V348), A350 (≠ S351), G351 (≠ A352), D380 (≠ G382), R383 (= R385), T384 (≠ A386)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
25% identity, 89% coverage: 11:404/444 of query aligns to 7:396/396 of 6bmiA
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
27% identity, 89% coverage: 37:429/444 of query aligns to 79:515/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
26% identity, 85% coverage: 37:412/444 of query aligns to 49:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I60), S80 (≠ V69), G81 (= G70), G84 (= G73), Y91 (≠ F80), M156 (≠ V160), F160 (≠ C164), F286 (≠ L294), V290 (≠ T298)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V52), I148 (≠ V152), S262 (= S271), S263 (≠ D272), A292 (≠ Y300), T293 (≠ S301), M296 (≠ L304), T299 (≠ F307), G329 (= G344), A336 (≠ S351), G337 (≠ A352), D366 (≠ G382), R369 (= R385), N373 (= N389)
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
26% identity, 89% coverage: 37:429/444 of query aligns to 79:515/532 of P43007
- N201 (≠ T129) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ E133) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ D185) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ I383) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
27% identity, 76% coverage: 62:397/444 of query aligns to 71:413/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S271), D398 (≠ G382), R401 (= R385), T402 (≠ A386), N405 (= N389)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (= P349), D398 (≠ G382), R401 (= R385), T402 (≠ A386)
- binding cholesterol hemisuccinate: I258 (= I233)
Sites not aligning to the query:
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
27% identity, 76% coverage: 62:397/444 of query aligns to 71:413/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S270), S287 (= S271), T324 (≠ F307), A358 (≠ T341), G361 (= G344), V365 (= V348), A368 (≠ S351), T372 (≠ I355), D398 (≠ G382), R401 (= R385), T402 (≠ A386), N405 (= N389)
- binding cholesterol hemisuccinate: K80 (≠ S71), R84 (≠ K75)
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 100% coverage: 2:443/444 of query aligns to 43:525/542 of P43003
- S363 (≠ T269) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ TSS 269:271) binding
- T396 (≠ S301) binding
- T402 (≠ F307) binding
- IPQAG 443:447 (≠ VPGSA 348:352) binding
- D476 (≠ G382) binding
- R477 (≠ I383) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N389) binding
- Y523 (≠ A441) mutation to F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
24% identity, 100% coverage: 2:443/444 of query aligns to 43:525/543 of P56564
- N206 (≠ D112) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (= N122) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Query Sequence
>HSERO_RS22690 FitnessBrowser__HerbieS:HSERO_RS22690
VSKLFKSLFGQVVLALIGGIIIGLFWPDFGQNLKPLGDGFIKLIKMIIPVIVFCVVVQGI
CGASDLKKVGSVGVKAIIYFEVVTTIALLLGLVLALVVQPGAGMNIDPSNLDASSLSGYM
ANAGKVKETGFAEFIMKLIPATAVSAFTSGDVLQVLLISVTFGCALLLIGEKGAPVVALV
ASLSDAFFKCMSFFIRLAPLGVLGAIAFTVGKYGIGSLKQLALLVLLFYGAVIFFVLVVL
GGILRASGLSIFKLIRYLREELVVVLATTSSDSVLPQIMKKLEHMGIKKSTVGLVIPTGY
SFNLDAFSIYLTMAALFIAQATNTHLSMGDLAAILAIALVTSKGAHGVPGSAIVILAATL
TTIPAIPVVGLVLVLSIDWFIGIARALGNLLGNCVATVVIASWERDIDKVRARAVLNGES
VAPLVEENPVIELMGVTVKPAQLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory