SitesBLAST
Comparing HSERO_RS22805 FitnessBrowser__HerbieS:HSERO_RS22805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 96% coverage: 10:576/590 of query aligns to 7:535/540 of 8jejA
- binding fe3-s4 cluster: R203 (≠ N220), C214 (= C236), C215 (= C242), G216 (≠ S243), N217 (≠ K244), N218 (≠ Y245), N219 (≠ P246), C220 (= C247), C224 (≠ S251), I226 (≠ A253), M229 (≠ Q256), S341 (≠ M373)
- binding flavin-adenine dinucleotide: I11 (≠ V14), G12 (= G15), G14 (= G17), I15 (≠ W18), C16 (≠ A19), D35 (≠ E38), A36 (≠ R39), G97 (= G96), K100 (vs. gap), G101 (= G98), G104 (= G101), T105 (≠ S102), T106 (≠ G103), H108 (= H105), W109 (= W106), A110 (≠ T107), S112 (≠ V109), M221 (≠ L248), A250 (≠ V277), V252 (≠ R279), A287 (≠ S313), N288 (≠ F314), E291 (≠ A317), N475 (≠ T516), H476 (= H517), N519 (= N560), T521 (= T562), M524 (≠ I565)
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
25% identity, 96% coverage: 10:576/590 of query aligns to 4:532/537 of 7w2jD
- binding fe3-s4 cluster: R200 (≠ N220), C211 (= C236), G213 (≠ S243), N214 (≠ K244), N215 (≠ Y245), C217 (= C247), C221 (≠ S251), I223 (≠ A253), A225 (≠ P255), S338 (≠ M373)
- binding flavin-adenine dinucleotide: G9 (= G15), G11 (= G17), D32 (≠ E38), A33 (≠ R39), Y59 (= Y50), K97 (vs. gap), G101 (= G101), T102 (≠ S102), T103 (≠ G103), H105 (= H105), W106 (= W106), S109 (≠ V109), V249 (≠ R279), A284 (≠ S313), N285 (≠ F314), E288 (≠ A317), K291 (≠ R320), L292 (= L321), N472 (≠ T516), N516 (= N560), S517 (≠ P561), T518 (= T562)
- binding heme c: P209 (≠ A234), I223 (≠ A253)
8grjB Crystal structure of gamma-alpha subunit complex from burkholderia cepacia fad glucose dehydrogenase in complex with gluconolactone
20% identity, 95% coverage: 22:579/590 of query aligns to 14:530/531 of 8grjB
- binding fe3-s4 cluster: C204 (= C236), C205 (= C242), G206 (≠ S243), N207 (≠ K244), N209 (≠ P246), C210 (= C247), C214 (≠ S251), P331 (≠ T370)
- binding flavin-adenine dinucleotide: E30 (= E38), A31 (≠ R39), Q86 (≠ R77), R89 (≠ T80), T94 (≠ S102), H97 (= H105), W98 (= W106), A99 (≠ T107), S101 (≠ V109), M211 (≠ L248), V242 (= V277), A277 (≠ S313), N278 (≠ F314), E281 (≠ A317), I285 (≠ L321), N467 (≠ K512), N511 (= N560), T513 (= T562)
- binding D-glucono-1,5-lactone: M211 (≠ L248), E333 (= E372), H355 (= H397), N466 (≠ T511), N467 (≠ K512), H468 (≠ Y513), N511 (= N560)
Sites not aligning to the query:
Query Sequence
>HSERO_RS22805 FitnessBrowser__HerbieS:HSERO_RS22805
MPDITNDDVDVVIVGLGWAGSLMAIELAQAGLKVRALERGPDRPPEDFAYPKPADQYGYA
TRNKVFATPRDAALTVRYNTAQQALPTRKWGAFAPGTGVGGSGLHWTAVLIRATPTDLKL
KTYADQAYKHSNLDPEMRIKDFPFTWNEIEPHYDFFDKVCGLSGTTGNLRGQIQPGGDPF
EGPRSNPYPLPALHDTYNNTLFADVARKLGYHPFPNPSANVSQAWTNPYGAQIAPCNYCG
FCSKYPCLNYSKASPQTTILDVVKRLPNFDYKVNANVIRVDLHADKKTARGVTYVDENMK
EVFQPAKIVILSSFQFANVRLMLLSGIGKPYDPITETGVIGRNYAFLSNGGATLFFKDKH
FNSFATAGATGEMFNDISPGNFDDGVKLGFIGGAKIHSSQASGAPIGTALPPGTPSWGRG
WKEGMIDWYDHSMKISITTTCMSYRGHFLDLDPNYKDPWGQPLLRMTFDWRQNELKLQRY
LRDIVLKISKELNPDHMSESFLALDSHWDITKYVSTHNVGGAIMGDSPRDSALNKYLQSW
DVHNVFVPGGNAFPQNFQANPTATIGAITLMAAHAIKTQYLKNPGPLVQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory