SitesBLAST
Comparing HSERO_RS22810 HSERO_RS22810 alcohol dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
44% identity, 98% coverage: 3:416/423 of query aligns to 19:434/478 of Q47945
- Q37 (= Q25) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
39% identity, 91% coverage: 32:418/423 of query aligns to 1:388/418 of 7w2jC
- binding heme c: C13 (= C44), C16 (= C47), H17 (= H48), I39 (= I69), S41 (= S71), T42 (= T72), N43 (= N73), I44 (= I74), I52 (= I82), Y55 (= Y85), F60 (= F90), A63 (= A93), L75 (= L105), Y76 (= Y106), A78 (= A108), M79 (= M109), P80 (= P110), Y84 (= Y114), R122 (= R152), H161 (= H190), C162 (= C191), C165 (= C194), H166 (= H195), W189 (= W223), R190 (≠ A224), A191 (≠ V225), P192 (= P226), I194 (≠ L228), W205 (= W234), Y213 (= Y242), L214 (= L243), R223 (≠ S252), P227 (≠ E256), M228 (= M257), L236 (≠ T265), V289 (≠ N322), C290 (= C323), C293 (= C326), H294 (= H327), Y305 (≠ I337), Y306 (≠ F338), P307 (= P339), L309 (= L341), N312 (≠ A344), T313 (= T345), T314 (≠ V346), T314 (≠ V346), Q317 (≠ A349), D322 (≠ A354), L323 (= L355), S326 (≠ V358), I327 (= I359), V331 (≠ A363), R333 (= R364), I340 (≠ L375), M342 (= M377), P343 (= P378), F345 (= F380)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
45% identity, 24% coverage: 317:416/423 of query aligns to 24:121/121 of 8hddB
- binding protoporphyrin ix containing fe: N29 (= N322), C30 (= C323), C33 (= C326), H34 (= H327), Y45 (≠ I337), Y46 (≠ F338), P47 (= P339), T54 (≠ V346), V66 (= V358), I67 (= I359), R73 (= R364), I80 (≠ L375), M82 (= M377), P83 (= P378), F85 (= F380)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
38% identity, 28% coverage: 297:416/423 of query aligns to 318:438/438 of 2zooA
- binding beta-D-fructofuranose: P359 (= P335), G360 (= G336), A361 (≠ I337)
- binding protoporphyrin ix containing fe: N346 (= N322), C347 (= C323), C350 (= C326), H351 (= H327), F362 (= F338), P363 (= P339), P364 (≠ V340), L365 (= L341), S368 (≠ A344), Y370 (≠ V346), L371 (≠ V347), I382 (= I359), L386 (≠ A363), S387 (≠ R364), G388 (≠ T365), I390 (vs. gap), V392 (≠ T368), Y397 (≠ S373), N398 (≠ I374), G399 (≠ L375), V400 (= V376), M401 (= M377), M404 (≠ H382), V414 (≠ L392)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
31% identity, 29% coverage: 295:417/423 of query aligns to 334:456/457 of 4ax3D
- binding heme c: T362 (≠ N322), C363 (= C323), C366 (= C326), H367 (= H327), P379 (= P339), P380 (≠ V340), L381 (= L341), S384 (≠ A344), F386 (≠ V346), L387 (≠ V347), I397 (≠ V358), V398 (≠ I359), L402 (≠ A363), N403 (≠ R364), G404 (≠ T365), I406 (≠ S367), V408 (≠ E369), Y413 (≠ I374), D414 (vs. gap), S415 (≠ L375), V416 (= V376), M417 (= M377), M420 (≠ F380), I431 (≠ L392)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5ocbA Crystal structure of nitric oxide bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
31% identity, 29% coverage: 295:417/423 of query aligns to 332:454/456 of 5ocbA
- binding heme c: T360 (≠ N322), C361 (= C323), C364 (= C326), H365 (= H327), P377 (= P339), P378 (≠ V340), L379 (= L341), S382 (≠ A344), F384 (≠ V346), L385 (≠ V347), I395 (≠ V358), V396 (≠ I359), L400 (≠ A363), N401 (≠ R364), G402 (≠ T365), I404 (≠ S367), V406 (≠ E369), Y411 (≠ I374), D412 (vs. gap), S413 (≠ L375), V414 (= V376), M415 (= M377), M418 (≠ F380), I429 (≠ L392)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitric oxide: 94, 131
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
31% identity, 29% coverage: 295:417/423 of query aligns to 332:454/456 of 5oboA
- binding heme c: T360 (≠ N322), C361 (= C323), C364 (= C326), H365 (= H327), P377 (= P339), P378 (≠ V340), L379 (= L341), S382 (≠ A344), F384 (≠ V346), L385 (≠ V347), I395 (≠ V358), V396 (≠ I359), L400 (≠ A363), N401 (≠ R364), G402 (≠ T365), I404 (≠ S367), V406 (≠ E369), Y411 (≠ I374), D412 (vs. gap), S413 (≠ L375), V414 (= V376), M415 (= M377), M418 (≠ F380)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
31% identity, 29% coverage: 295:417/423 of query aligns to 331:453/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ N322), C360 (= C323), C363 (= C326), H364 (= H327), P376 (= P339), P377 (≠ V340), L378 (= L341), S381 (≠ A344), F383 (≠ V346), L384 (≠ V347), I394 (≠ V358), V395 (≠ I359), L399 (≠ A363), N400 (≠ R364), G401 (≠ T365), I403 (≠ S367), V405 (≠ E369), Y410 (≠ I374), D411 (vs. gap), S412 (≠ L375), V413 (= V376), M414 (= M377), M417 (≠ F380), I428 (≠ L392)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
37% identity, 24% coverage: 315:417/423 of query aligns to 2:111/129 of 1dt1A
- binding heme c: Q8 (≠ N322), C9 (= C323), C12 (= C326), H13 (= H327), F24 (= F338), P25 (= P339), L27 (= L341), H30 (vs. gap), I34 (≠ V346), Y43 (vs. gap), V47 (= V358), L48 (≠ I359), L52 (≠ A363), Q53 (≠ R364), G54 (≠ T365), I56 (≠ S367), Y63 (≠ I374), N64 (≠ L375), G65 (vs. gap), V66 (= V376), M67 (= M377), F70 (= F380), I85 (≠ V396)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
37% identity, 24% coverage: 315:417/423 of query aligns to 3:112/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: Y7 (= Y319), C10 (= C323), C13 (= C326), H14 (= H327), F25 (= F338), P26 (= P339), L28 (= L341), H31 (vs. gap), I35 (≠ V346), Y44 (vs. gap), V48 (= V358), L49 (≠ I359), L53 (≠ A363), Q54 (≠ R364), G55 (≠ T365), I57 (≠ S367), Y64 (≠ I374), N65 (≠ L375), G66 (vs. gap), V67 (= V376), M68 (= M377), F71 (= F380), V82 (≠ L392), I86 (≠ V396)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
37% identity, 24% coverage: 315:417/423 of query aligns to 3:112/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y319), C10 (= C323), C13 (= C326), H14 (= H327), F25 (= F338), P26 (= P339), L28 (= L341), H31 (vs. gap), I35 (≠ V346), Y44 (vs. gap), V48 (= V358), L49 (≠ I359), L53 (≠ A363), Q54 (≠ R364), G55 (≠ T365), I57 (≠ S367), Y64 (≠ I374), N65 (≠ L375), G66 (vs. gap), V67 (= V376), M68 (= M377), F71 (= F380), I86 (≠ V396)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
37% identity, 24% coverage: 315:417/423 of query aligns to 4:113/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C323), C14 (= C326), H15 (= H327), F26 (= F338), P27 (= P339), L29 (= L341), H32 (vs. gap), I36 (≠ V346), Y45 (vs. gap), V49 (= V358), L50 (≠ I359), L54 (≠ A363), Q55 (≠ R364), G56 (≠ T365), I58 (≠ S367), Y65 (≠ I374), N66 (≠ L375), G67 (vs. gap), V68 (= V376), M69 (= M377), F72 (= F380), I87 (≠ V396)
Sites not aligning to the query:
Query Sequence
>HSERO_RS22810 HSERO_RS22810 alcohol dehydrogenase
MKKLTSLFAALAWSLGALGTLTTAQAADQDLVARGQYLARAGDCMACHSAAGKPAYSGGL
AIDSGHGIIYSTNITPDKEHGIGNYSEAQFSAAVRHGVRADGTQLYPAMPYPSYAKVSDE
DIHALYTYFMQGVQPVASTPPASSMSFPFNIRWGMKLWNVFFANDKPFREQDGWSAEIKR
GAYLVEGLGHCGSCHTPRGVAMNEKASDSSQAQFLSGGDLNGWAVPSLRGMPHWSAQDIV
DYLQTGRNKTASVAGEMSLVVEHSTSHLKREDLQAMAAYLKTLSPVASSGSGRVIPQGVD
ATVSKLTAAKDLTLGERLYLDNCAACHFVTGRGAPGIFPVLDGATVVNAENPSALLHVIL
AGARTPSTEKAPSILVMPGFAHRLSDEEAAALATFVRQGWGNHAGKVSEREVGKLRAGMD
KQH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory