SitesBLAST
Comparing HSERO_RS23110 FitnessBrowser__HerbieS:HSERO_RS23110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1co6A Crystal structure of ferrocytochrome c2 from rhodopseudomonas viridis (see paper)
37% identity, 94% coverage: 5:103/105 of query aligns to 2:100/107 of 1co6A
- binding heme c: C13 (= C16), C16 (= C19), H17 (= H20), P29 (= P32), S39 (≠ A42), Y47 (= Y50), S48 (= S51), N51 (≠ M54), W58 (= W61), F63 (≠ L66), I67 (≠ L70), T77 (≠ N80), K78 (= K81), M79 (= M82), F81 (= F84)
P00083 Cytochrome c2 from Blastochloris viridis (Rhodopseudomonas viridis) (see 2 papers)
36% identity, 91% coverage: 8:103/105 of query aligns to 25:120/127 of P00083
- C33 (= C16) binding covalent
- C36 (= C19) binding covalent
- H37 (= H20) binding axial binding residue
- M99 (= M82) binding axial binding residue
Sites not aligning to the query:
- 1:20 signal peptide
- 21 modified: Pyrrolidone carboxylic acid
- 21:127 modified: mature protein, Cytochrome c2
P00004 Cytochrome c from Equus caballus (Horse) (see 2 papers)
40% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P00004
- G2 (= G4) modified: N-acetylglycine
- H19 (= H20) binding axial binding residue
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6suvAaA Cytochrome c
40% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 6suvAaA
- binding heme c: C14 (= C16), C17 (= C19), H18 (= H20), T28 (≠ F30), G29 (= G31), P30 (= P32), L35 (≠ V37), T40 (≠ A42), G41 (= G43), Y48 (= Y50), T49 (≠ S51), N52 (≠ M54), W59 (= W61), Y67 (≠ F69), L68 (= L70), T78 (≠ N80), K79 (= K81), M80 (= M82), F82 (= F84)
- binding octa-anionic calixarene: E4 (≠ A7), K7 (≠ R10), K8 (≠ A11), V11 (≠ A14), K72 (≠ S74), K73 (≠ D75), P76 (= P78), K86 (≠ G88), K87 (≠ S89), K88 (≠ D90), T89 (≠ K91), E90 (≠ Q92)
4rszA The x-ray structure of the primary adduct formed in the reaction between cisplatin and cytochromE C (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 4rszA
- binding Cisplatin: E61 (= E63), M65 (≠ R67), E92 (≠ D94)
- binding heme c: K13 (= K15), C14 (= C16), C17 (= C19), H18 (= H20), G29 (= G31), P30 (= P32), Y48 (= Y50), T49 (≠ S51), N52 (≠ M54), W59 (= W61), Y67 (≠ F69), T78 (≠ N80), K79 (= K81), M80 (= M82), I81 (≠ R83)
1wejF Igg1 fab fragment (of e8 antibody) complexed with horse cytochromE C at 1.8 a resolution (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 1wejF
- binding protoporphyrin ix containing fe: K13 (= K15), C14 (= C16), C17 (= C19), H18 (= H20), G29 (= G31), P30 (= P32), G41 (= G43), Y48 (= Y50), T49 (≠ S51), N52 (≠ M54), W59 (= W61), Y67 (≠ F69), L68 (= L70), T78 (≠ N80), K79 (= K81), M80 (= M82), F82 (= F84)
1m60A Solution structure of zinc-substituted cytochromE C (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 1m60A
- binding zinc substituted heme c: K13 (= K15), C14 (= C16), C17 (= C19), H18 (= H20), T28 (≠ F30), L32 (= L34), T40 (≠ A42), G41 (= G43), Y48 (= Y50), T49 (≠ S51), N52 (≠ M54), W59 (= W61), Y67 (≠ F69), L68 (= L70), K79 (= K81), M80 (= M82), F82 (= F84), L94 (≠ I96)
1fi7A Solution structure of the imidazole complex of cytochromE C (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 1fi7A
- binding heme c: C14 (= C16), C17 (= C19), H18 (= H20), T28 (≠ F30), G29 (= G31), P30 (= P32), L32 (= L34), N52 (≠ M54), W59 (= W61), L64 (= L66), L68 (= L70), K79 (= K81)
- binding imidazole: Y67 (≠ F69), K79 (= K81)
1akkA Solution structure of oxidized horse heart cytochromE C, nmr, minimized average structure (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 1akkA
- binding heme c: C14 (= C16), C17 (= C19), H18 (= H20), T28 (≠ F30), T40 (≠ A42), Y48 (= Y50), T49 (≠ S51), N52 (≠ M54), W59 (= W61), Y67 (≠ F69), T78 (≠ N80), K79 (= K81), M80 (= M82), F82 (= F84), L94 (≠ I96)
P00014 Cytochrome c from Macropus giganteus (Eastern gray kangaroo) (see paper)
41% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P00014
- G2 (= G4) modified: N-acetylglycine
- C15 (= C16) binding covalent
- C18 (= C19) binding covalent
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P81280 Cytochrome c from Alligator mississippiensis (American alligator) (see paper)
41% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P81280
- G2 (= G4) modified: N-acetylglycine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P99999 Cytochrome c from Homo sapiens (Human) (see 4 papers)
39% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P99999
- G2 (= G4) modified: N-acetylglycine
- K6 (≠ A8) mutation K->A,D,R: No effect on covalent heme attachment.
- F11 (= F13) mutation to A: Decreased covalent heme attachment.; mutation to Y: No effect on covalent heme attachment.
- C15 (= C16) binding covalent; mutation to S: Decreased covalent heme attachment.
- C18 (= C19) binding covalent; mutation to A: Decreased covalent heme attachment.
- H19 (= H20) binding axial binding residue; mutation to A: Loss of covalent heme attachment.
- G42 (= G43) to S: in THC4; increases the pro-apoptotic function by triggering caspase activation more efficiently than wild-type; does not affect the redox function; dbSNP:rs121918552
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6ff5A X-ray structure of bovine heart cytochromE C at high ionic strength (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 6ff5A
- binding heme c: K13 (= K15), C14 (= C16), C17 (= C19), H18 (= H20), G29 (= G31), P30 (= P32), G41 (= G43), Y48 (= Y50), T49 (≠ S51), N52 (≠ M54), W59 (= W61), Y67 (≠ F69), T78 (≠ N80), K79 (= K81), M80 (= M82), I81 (≠ R83), F82 (= F84)
- binding nitrate ion: E69 (≠ K71), K86 (≠ G88), K87 (≠ S89), E90 (≠ Q92)
- binding sulfate ion: K7 (≠ R10)
Sites not aligning to the query:
P62894 Cytochrome c from Bos taurus (Bovine) (see 3 papers)
40% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P62894
- G2 (= G4) modified: N-acetylglycine
- Y49 (= Y50) modified: Phosphotyrosine
- Y98 (= Y99) modified: Phosphotyrosine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P21665 Cytochrome c from Varanus varius (Lace monitor lizard) (Lacerta varia) (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P21665
- G2 (= G4) modified: N-acetylglycine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P00028 Cytochrome c from Entosphenus tridentatus (Pacific lamprey) (Lampetra tridentata) (see paper)
39% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P00028
- G2 (= G4) modified: N-acetylglycine
- C15 (= C16) binding covalent
- C18 (= C19) binding covalent
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P00002 Cytochrome c from Macaca mulatta (Rhesus macaque) (see paper)
39% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P00002
- G2 (= G4) modified: N-acetylglycine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P00015 Cytochrome c, testis-specific from Mus musculus (Mouse) (see paper)
39% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P00015
- G2 (= G4) modified: N-acetylglycine
- C15 (= C16) binding covalent
- C18 (= C19) binding covalent
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P00007 Cytochrome c from Hippopotamus amphibius (Hippopotamus) (see paper)
40% identity, 93% coverage: 4:101/105 of query aligns to 2:100/105 of P00007
- G2 (= G4) modified: N-acetylglycine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2aiuA Crystal structure of mouse testicular cytochromE C at 1.6 angstrom (see paper)
39% identity, 93% coverage: 4:101/105 of query aligns to 1:99/104 of 2aiuA
- binding protoporphyrin ix containing fe: C14 (= C16), Q16 (≠ S18), C17 (= C19), H18 (= H20), P30 (= P32), L35 (≠ V37), G41 (= G43), Y48 (= Y50), T49 (≠ S51), N52 (≠ M54), W59 (= W61), Y67 (≠ F69), L68 (= L70), T78 (≠ N80), K79 (= K81), M80 (= M82), F82 (= F84)
Query Sequence
>HSERO_RS23110 FitnessBrowser__HerbieS:HSERO_RS23110
LAAGDVAAGRAAFAKCASCHAVGPSARAGFGPQLSNVIGRKAGSTPDFKYSPAMANAGFV
WTEDKLRAFLKAPSDVVPGNKMRFWGIGSDKQIDDILAYLRTFKP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory