SitesBLAST – Find functional sites

 

SitesBLAST

Comparing HSERO_RS23185 FitnessBrowser__HerbieS:HSERO_RS23185 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 5 hits to proteins with known functional sites (download)

Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
56% identity, 97% coverage: 5:214/216 of query aligns to 302:509/520 of Q29551

query
sites
Q29551
R
 
R
D
 
E
E
 
R
M
 
I
A
 
I
A
 
K
R
 
R
A
 
A
A
 
A
K
 
L
E
 
E
L
 
F
Q
 
E
D
 
D
G
 
G
F
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
 
I
G
 
G
L
 
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
V
 
I
P
 
S
S
 
P
D
 
N
I
 
M
E
 
T
V
 
V
W
 
H
L
 
L
Q
 
Q
S
 
S
E
|
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
I
 
L
G
 
G
P
 
P
F
 
Y
P
 
P
T
 
L
E
 
Q
D
 
N
Q
 
E
V
 
V
D
 
D
P
 
A
D
 
D
L
 
L
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
E
T
 
T
V
 
V
T
 
T
T
 
V
I
 
L
P
 
P
G
 
G
S
 
A
S
 
S
F
 
Y
F
 
F
S
 
S
S
 
S
A
 
D
D
 
E
S
 
S
F
 
F
G
 
A
M
 
M
I
 
I
R
 
R
G
 
G
G
 
G
K
 
H
I
 
V
N
 
N
I
 
L
A
 
T
I
 
M
L
 
L
G
 
G
A
 
A
M
 
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
W
M
 
M
I
 
I
P
 
P
G
 
G
K
 
K
M
 
L
V
 
V
K
 
K
G
 
G
M
 
M
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
V
 
V
A
 
S
G
 
S
V
 
A
G
 
K
-
 
T
R
 
K
V
 
V
V
 
V
V
 
V
L
 
T
M
 
M
E
 
E
H
 
H
V
 
S
A
 
A
K
 
K
A
 
G
K
 
-
D
 
-
G
 
-
S
 
-
T
 
N
S
 
A
K
 
H
K
 
K
I
 
I
L
 
M
N
 
E
D
 
K
C
 
C
N
 
T
L
 
L
P
 
P
L
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
V
 
C
V
 
V
N
 
N
R
 
R
I
 
I
I
 
I
T
 
T
D
 
E
L
 
K
G
 
A
V
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
S
P
 
K
G
 
K
G
 
G
L
 
L
K
 
T
L
 
L
I
 
I
E
 
E
L
 
L
A
 
W
S
 
E
G
 
G
V
 
L
T
 
T
K
 
V
E
 
D
E
 
D
V
 
I
I
 
K
E
 
K
K
 
S
T
 
T
E
 
G
A
 
C
P
 
D
L
 
F
D
 
A
V
 
V
S
 
S

Sites not aligning to the query:

3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
56% identity, 97% coverage: 5:214/216 of query aligns to 249:456/466 of 3k6mC

query
sites
3k6mC
R
 
R
D
 
E
E
 
R
M
 
I
A
 
I
A
 
K
R
 
R
A
 
A
A
 
A
K
 
L
E
 
E
L
 
F
Q
 
E
D
 
D
G
 
G
F
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
|
I
G
 
G
L
 
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
V
 
I
P
 
S
S
 
P
D
 
N
I
 
M
E
 
T
V
 
V
W
 
H
L
 
L
Q
 
Q
S
 
S
E
|
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
I
 
L
G
 
G
P
 
P
F
 
Y
P
 
P
T
 
L
E
 
Q
D
 
N
Q
 
E
V
 
V
D
 
D
P
 
A
D
 
D
L
 
L
I
 
I
N
 
N
A
|
A
G
 
G
K
 
K
Q
 
E
T
 
T
V
 
V
T
 
T
T
 
V
I
 
L
P
 
P
G
 
G
S
 
A
S
 
S
F
 
Y
F
 
F
S
 
S
S
 
S
A
 
D
D
 
E
S
 
S
F
 
F
G
 
A
M
 
M
I
 
I
R
 
R
G
 
G
G
 
G
K
 
H
I
 
V
N
 
N
I
 
L
A
 
T
I
 
M
L
 
L
G
 
G
A
 
A
M
 
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
W
M
 
M
I
 
I
P
 
P
G
 
G
K
 
K
M
 
L
V
 
V
K
 
K
G
 
G
M
 
M
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
V
|
V
A
 
S
G
 
S
V
x
A
G
 
K
-
x
T
R
 
K
V
 
V
V
 
V
V
 
V
L
 
T
M
 
M
E
 
E
H
 
H
V
 
S
A
 
A
K
 
K
A
 
G
K
 
-
D
 
-
G
 
-
S
 
-
T
 
N
S
 
A
K
 
H
K
 
K
I
 
I
L
 
M
N
 
E
D
 
K
C
 
C
N
 
T
L
 
L
P
 
P
L
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
V
x
C
V
 
V
N
|
N
R
 
R
I
 
I
I
 
I
T
 
T
D
 
E
L
 
K
G
 
A
V
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
R
P
 
K
G
 
K
G
 
G
L
 
L
K
 
T
L
 
L
I
 
I
E
 
E
L
 
L
A
 
W
S
 
E
G
 
G
V
 
L
T
 
T
K
 
V
E
 
D
E
 
D
V
 
I
I
 
K
E
 
K
K
 
S
T
 
T
E
 
G
A
 
C
P
 
D
L
 
F
D
 
A
V
 
V
S
 
S

Sites not aligning to the query:

1o9lA Succinate:coenzyme-a transferase (pig heart)
56% identity, 97% coverage: 5:214/216 of query aligns to 250:457/468 of 1o9lA

query
sites
1o9lA
R
 
R
D
 
E
E
 
R
M
 
I
A
 
I
A
 
K
R
 
R
A
 
A
A
 
A
K
 
L
E
 
E
L
 
F
Q
 
E
D
 
D
G
 
G
F
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
 
I
G
 
G
L
 
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
V
 
I
P
 
S
S
 
P
D
 
N
I
 
M
E
 
T
V
 
V
W
 
H
L
 
L
Q
 
Q
S
 
S
E
 
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
I
 
L
G
 
G
P
 
P
F
 
Y
P
 
P
T
 
L
E
 
Q
D
 
N
Q
 
E
V
 
V
D
 
D
P
 
A
D
 
D
L
 
L
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
E
T
 
T
V
 
V
T
 
T
T
 
V
I
 
L
P
 
P
G
 
G
S
 
A
S
 
S
F
 
Y
F
 
F
S
 
S
S
 
S
A
 
D
D
 
E
S
 
S
F
 
F
G
 
A
M
 
M
I
 
I
R
 
R
G
 
G
G
 
G
K
 
H
I
 
V
N
 
N
I
 
L
A
 
T
I
 
M
L
 
L
G
 
G
A
 
A
M
 
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
W
M
 
M
I
 
I
P
 
P
G
 
G
K
 
K
M
 
L
V
 
V
K
 
K
G
 
G
M
 
M
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
V
 
V
A
 
S
G
 
S
V
 
A
G
 
K
-
 
T
R
 
K
V
 
V
V
 
V
V
 
V
L
 
T
M
 
M
E
 
E
H
 
H
V
 
S
A
 
A
K
 
K
A
 
G
K
 
-
D
 
-
G
 
-
S
 
-
T
 
N
S
 
A
K
 
H
K
 
K
I
 
I
L
 
M
N
 
E
D
 
K
C
 
C
N
 
T
L
 
L
P
 
P
L
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
V
 
C
V
 
V
N
 
N
R
 
R
I
 
I
I
 
I
T
 
T
D
 
E
L
 
K
G
 
A
V
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
R
P
 
K
G
 
K
G
 
G
L
 
L
K
 
T
L
 
L
I
 
I
E
 
E
L
 
L
A
 
W
S
 
E
G
 
G
V
 
L
T
 
T
K
 
V
E
 
D
E
 
D
V
 
I
I
 
K
E
 
K
K
 
S
T
 
T
E
 
G
A
 
C
P
 
D
L
 
F
D
 
A
V
 
V
S
 
S

Sites not aligning to the query:

3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
57% identity, 94% coverage: 11:214/216 of query aligns to 251:452/462 of 3oxoE

query
sites
3oxoE
R
 
R
A
 
A
A
 
A
K
 
L
E
 
E
L
 
F
Q
 
E
D
 
D
G
 
G
F
 
M
Y
 
Y
V
 
A
N
 
N
L
 
L
G
 
G
I
|
I
G
|
G
L
x
I
P
 
P
T
 
L
L
 
L
V
 
A
A
 
S
N
 
N
H
 
F
V
 
I
P
 
S
S
 
P
D
 
N
I
 
M
E
 
T
V
 
V
W
 
H
L
 
L
Q
 
Q
S
 
S
E
|
E
N
 
N
G
 
G
L
 
I
L
 
L
G
 
G
I
 
L
G
 
G
P
 
P
F
 
Y
P
 
P
T
 
L
E
 
Q
D
 
N
Q
 
E
V
 
V
D
 
D
P
 
A
D
 
D
L
 
L
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
E
T
 
T
V
 
V
T
 
T
T
 
V
I
 
L
P
 
P
G
 
G
S
 
A
S
 
S
F
 
Y
F
 
F
S
 
S
S
 
S
A
 
D
D
 
E
S
 
S
F
 
F
G
 
A
M
 
M
I
 
I
R
 
R
G
 
G
G
 
G
K
 
H
I
 
V
N
 
N
I
 
L
A
 
T
I
 
M
L
 
L
G
|
G
A
 
A
M
|
M
Q
 
Q
V
 
V
S
 
S
A
 
K
K
 
Y
G
 
G
D
 
D
L
 
L
A
 
A
N
|
N
W
 
W
M
 
M
I
|
I
P
 
P
G
 
G
K
 
K
M
 
L
V
 
V
K
 
K
G
 
G
M
|
M
G
 
G
G
 
G
A
|
A
M
 
M
D
 
D
L
 
L
V
 
V
A
 
S
G
 
S
V
 
A
G
 
K
-
 
T
R
 
K
V
 
V
V
 
V
V
 
V
L
 
T
M
 
M
E
 
E
H
 
H
V
 
S
A
 
A
K
|
K
A
 
G
K
 
-
D
 
-
G
 
-
S
 
-
T
 
N
S
 
A
K
 
H
K
 
K
I
 
I
L
 
M
N
 
E
D
 
K
C
 
C
N
 
T
L
 
L
P
 
P
L
 
L
T
 
T
G
 
G
V
 
K
G
 
Q
V
 
C
V
 
V
N
 
N
R
 
R
I
 
I
I
 
I
T
 
T
D
 
E
L
 
K
G
 
A
V
 
V
I
 
F
D
 
D
V
 
V
-
 
D
T
 
R
P
 
K
G
 
K
G
 
G
L
 
L
K
 
T
L
 
L
I
 
I
E
 
E
L
 
L
A
 
W
S
 
E
G
 
G
V
 
L
T
 
T
K
 
V
E
 
D
E
 
D
V
 
I
I
 
K
E
 
K
K
 
S
T
 
T
E
 
G
A
 
C
P
 
D
L
 
F
D
 
A
V
 
V
S
 
S

6lp1C Crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. (see paper)
54% identity, 96% coverage: 5:212/216 of query aligns to 254:457/469 of 6lp1C

query
sites
6lp1C
R
 
R
D
 
Q
E
 
R
M
 
I
A
 
A
A
 
R
R
 
R
A
 
A
A
 
A
K
 
L
E
 
E
L
 
F
Q
 
A
D
 
N
G
 
G
F
 
M
Y
 
Y
V
 
V
N
 
N
L
 
L
G
 
G
I
 
I
G
 
G
L
 
I
P
 
P
T
 
T
L
 
E
V
 
S
A
 
S
N
 
N
H
 
Y
V
 
I
P
 
P
S
 
A
D
 
G
I
 
V
E
 
N
V
 
V
W
 
V
L
 
L
Q
 
Q
S
 
S
E
 
E
N
 
N
G
 
G
L
 
L
L
 
I
G
 
G
I
 
M
G
 
G
P
 
P
F
 
F
P
 
P
T
 
T
E
 
E
D
 
D
Q
 
K
V
 
V
D
 
D
P
 
A
D
 
D
L
 
W
I
 
I
N
 
N
A
 
A
G
 
G
K
 
K
Q
 
Q
T
 
T
V
 
I
T
 
S
T
 
H
I
 
L
P
 
A
G
 
G
S
 
S
S
 
A
F
 
L
F
 
F
S
 
D
S
 
S
A
 
A
D
 
T
S
 
S
F
 
F
G
 
A
M
 
M
I
 
I
R
 
R
G
 
G
G
 
G
K
 
H
I
 
M
N
 
D
I
 
L
A
 
T
I
 
M
L
 
L
G
 
G
A
 
A
M
 
L
Q
 
E
V
 
V
S
 
A
A
 
A
K
 
N
G
 
G
D
 
D
L
 
L
A
 
A
N
 
N
W
 
F
M
 
M
I
 
I
P
 
P
G
 
G
K
 
K
M
 
L
V
 
V
K
 
K
G
 
G
M
 
P
G
 
G
G
 
G
A
 
A
M
 
M
D
 
D
L
 
L
V
 
V
A
 
S
G
 
C
V
 
G
G
 
T
R
 
R
V
 
V
V
 
V
V
 
V
L
 
T
M
 
T
E
 
T
H
 
H
V
 
C
A
 
N
K
 
K
A
 
N
K
 
G
D
 
D
G
 
-
S
 
-
T
 
-
S
 
-
K
 
P
K
 
K
I
 
I
L
 
V
N
 
E
D
 
R
C
 
C
N
 
R
L
 
L
P
 
P
L
 
V
T
 
T
G
 
G
V
 
K
G
 
H
V
 
C
V
 
V
N
 
C
R
 
R
I
 
I
I
 
I
T
 
T
D
 
E
L
 
Y
G
 
A
V
 
V
I
 
F
D
 
D
V
 
V
T
 
V
P
 
D
G
 
G
G
 
R
L
 
L
K
 
V
L
 
L
I
 
K
E
 
E
L
 
I
A
 
A
S
 
E
G
 
D
V
 
T
T
 
T
K
 
V
E
 
D
E
 
Q
V
 
V
I
 
K
E
 
K
K
 
L
T
 
T
E
 
G
A
 
V
P
 
G
L
 
F
D
 
D

Sites not aligning to the query:

Query Sequence

>HSERO_RS23185 FitnessBrowser__HerbieS:HSERO_RS23185
MAWTRDEMAARAAKELQDGFYVNLGIGLPTLVANHVPSDIEVWLQSENGLLGIGPFPTED
QVDPDLINAGKQTVTTIPGSSFFSSADSFGMIRGGKINIAILGAMQVSAKGDLANWMIPG
KMVKGMGGAMDLVAGVGRVVVLMEHVAKAKDGSTSKKILNDCNLPLTGVGVVNRIITDLG
VIDVTPGGLKLIELASGVTKEEVIEKTEAPLDVSEL

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory