SitesBLAST
Comparing HSERO_RS23270 HSERO_RS23270 ABC transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
49% identity, 98% coverage: 1:230/234 of query aligns to 5:239/240 of 1ji0A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
36% identity, 97% coverage: 3:229/234 of query aligns to 3:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (= Y12), N37 (= N37), G38 (= G38), G40 (= G40), K41 (= K41), T42 (= T42), T43 (= T43), Q84 (≠ E84), S136 (≠ Q130), S138 (= S132), G139 (= G133), G140 (= G134), E162 (= E156), G166 (= G160), H194 (≠ Q188)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
35% identity, 98% coverage: 3:232/234 of query aligns to 3:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
35% identity, 98% coverage: 3:232/234 of query aligns to 3:238/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (= Y12), R15 (≠ S15), N37 (= N37), G40 (= G40), K41 (= K41), T42 (= T42), T43 (= T43), Q84 (≠ E84), S136 (≠ Q130), S138 (= S132), E141 (= E135)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
34% identity, 97% coverage: 2:229/234 of query aligns to 2:235/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
35% identity, 98% coverage: 3:232/234 of query aligns to 4:239/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
36% identity, 97% coverage: 3:228/234 of query aligns to 3:234/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (= Y12), R15 (≠ S15), V17 (≠ I17), N37 (= N37), G38 (= G38), G40 (= G40), K41 (= K41), T42 (= T42), T43 (= T43)
- binding magnesium ion: T42 (= T42), Q84 (≠ E84)
- binding novobiocin: L71 (≠ S71), H72 (≠ Y72), P83 (= P83), A86 (≠ R86), S87 (≠ G87), F89 (= F89), R90 (≠ K90), R91 (≠ L91), L92 (= L92), V101 (vs. gap), Q135 (≠ G129), R149 (= R143)
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
36% identity, 97% coverage: 3:228/234 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
35% identity, 96% coverage: 3:227/234 of query aligns to 3:233/233 of 6b8bA
- binding adenosine-5'-diphosphate: Y12 (= Y12), R15 (≠ S15), V17 (≠ I17), G38 (= G38), G40 (= G40), K41 (= K41), T42 (= T42), T43 (= T43)
- binding (3s,5s,7s)-N-{7-[(3-O-carbamoyl-6-deoxy-5-methyl-4-O-methyl-beta-D-gulopyranosyl)oxy]-4-hydroxy-8-methyl-2-oxo-2H-1-benzopyran-3-yl}tricyclo[3.3.1.1~3,7~]decane-1-carboxamide: F89 (= F89), R90 (≠ K90), R91 (≠ L91)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 97% coverage: 2:229/234 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 97% coverage: 2:229/234 of query aligns to 4:253/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 93% coverage: 2:219/234 of query aligns to 2:225/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 91% coverage: 5:218/234 of query aligns to 4:224/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y12), V16 (≠ I17), S36 (≠ N37), G37 (= G38), S38 (≠ A39), G39 (= G40), K40 (= K41), S41 (≠ T42), T42 (= T43), E162 (= E156), H194 (≠ Q188)
- binding magnesium ion: S41 (≠ T42), E162 (= E156)
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
27% identity, 96% coverage: 2:225/234 of query aligns to 3:229/247 of P55339
- G164 (= G160) mutation to E: In ecsA-26; exoamylase and other exoenzymes decrease, competence- and sporulation-deficient phenotype.
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 92% coverage: 3:218/234 of query aligns to 1:226/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 92% coverage: 3:218/234 of query aligns to 1:226/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 92% coverage: 3:218/234 of query aligns to 1:226/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 92% coverage: 3:218/234 of query aligns to 1:226/242 of 2oljA
7roqA Alternative structure of human abca1
33% identity, 87% coverage: 18:221/234 of query aligns to 787:991/1831 of 7roqA
Sites not aligning to the query:
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
32% identity, 84% coverage: 18:214/234 of query aligns to 916:1115/2261 of O95477
- D917 (≠ Q19) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ V31) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- N935 (= N37) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K41) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ A140) modified: Phosphoserine; by PKA
- P1065 (= P163) natural variant: P -> S
- M1091 (≠ L190) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- C1110 (≠ V209) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- C1111 (≠ Y210) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
Query Sequence
>HSERO_RS23270 HSERO_RS23270 ABC transporter
MILQVEDVHGYYGKSHILQGVSLQVDAGEVVTLLGRNGAGKTTTLKSIVGVVPPVQGRVL
FEGQLISGLPSYKIAARGVCLVPEHRGIFKLLTVEENLTMAARKESAWGLEEIYAIFPRL
KERRKNGGGQLSGGEQQMLAIARALMTHPRVLMLDEPVEGLAPVIVDEIVAQIRQIKATG
MSIILVEQNLEVCTQLADRHYIVEQGRIVYHGSNAEFLADEGVKDRYLGVNLAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory