Comparing HSERO_RS23725 FitnessBrowser__HerbieS:HSERO_RS23725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7uoiA Crystallographic structure of dape from enterococcus faecium
26% identity, 95% coverage: 19:411/414 of query aligns to 8:383/383 of 7uoiA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
24% identity, 99% coverage: 3:411/414 of query aligns to 3:422/426 of 3pfoA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
23% identity, 94% coverage: 22:410/414 of query aligns to 6:375/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
23% identity, 94% coverage: 22:410/414 of query aligns to 10:379/380 of 5vo3A
7rsfA Acetylornithine deacetylase from escherichia coli
27% identity, 87% coverage: 50:409/414 of query aligns to 35:377/380 of 7rsfA
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
29% identity, 53% coverage: 89:306/414 of query aligns to 69:300/407 of P37111
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
25% identity, 87% coverage: 22:382/414 of query aligns to 8:353/377 of 7lgpB
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 70% coverage: 89:377/414 of query aligns to 69:368/408 of Q03154
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
26% identity, 93% coverage: 26:410/414 of query aligns to 10:375/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
26% identity, 93% coverage: 26:410/414 of query aligns to 10:375/375 of 4pqaA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
24% identity, 81% coverage: 76:410/414 of query aligns to 48:375/377 of 7t1qA
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
28% identity, 35% coverage: 71:215/414 of query aligns to 61:204/470 of P45494
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
28% identity, 35% coverage: 71:215/414 of query aligns to 61:204/468 of 1lfwA
Sites not aligning to the query:
5k8pA Zn2+/tetrahedral intermediate-bound r289a 5-nitroanthranilate aminohydrolase (see paper)
25% identity, 94% coverage: 23:410/414 of query aligns to 16:417/421 of 5k8pA
5k8oB Mn2+/5nsa-bound 5-nitroanthranilate aminohydrolase (see paper)
25% identity, 94% coverage: 23:410/414 of query aligns to 20:421/425 of 5k8oB
5k8nA 5naa-bound 5-nitroanthranilate aminohydrolase (see paper)
25% identity, 94% coverage: 23:410/414 of query aligns to 15:416/420 of 5k8nA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
28% identity, 39% coverage: 22:184/414 of query aligns to 8:158/258 of 4h2kA
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
37% identity, 25% coverage: 89:192/414 of query aligns to 63:168/192 of 1q7lA
Sites not aligning to the query:
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
24% identity, 48% coverage: 174:372/414 of query aligns to 154:356/398 of 6slfA
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
25% identity, 70% coverage: 80:369/414 of query aligns to 5:284/392 of 7m6uB
Sites not aligning to the query:
>HSERO_RS23725 FitnessBrowser__HerbieS:HSERO_RS23725
MSKEQLSQRLCAWIDQHFDEEVGVLQQLIRIPTDTPPGNNAPHADAVAELVAGWGWAAEK
HVVPAQQVADYGMQSITNLIVRRPYGDGGPTLALNAHGDVVPPGEGWTHDPYGGEIADGR
IYGRAAAVSKSDFASYLFATRALEAVGASLRGGVELHFTYDEEFGGLLGPGWLLEQKLTR
PDYVLAAGFSYNVVTAHNACLQFEITVHGRATHGSMPETGHDALQAATAILNAIYGALPG
LKEIRSAIPGITHPTMIVGRIDGGTNTNVVPGKVVLKMDRRMIPEEDPSQVEAGVRKLIE
DAVAGLPGIRVEIRRLLLARALRPLPGHEKLVESLLRNAREVMGETLTTNGSALYTDARL
YGEQGIPVVLFGAGPRTLMESNAKQADENLALDDLRKATKVVALMLLDFLGPQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory