Comparing IAI46_00835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P0A890 Sulfur carrier protein TusA; Sulfur mediator TusA; Sulfur transfer protein TusA; tRNA 2-thiouridine synthesizing protein A from Escherichia coli (strain K12) (see 2 papers)
83% identity, 96% coverage: 1:80/83 of query aligns to 1:80/81 of P0A890
P0A892 Sulfur carrier protein TusA; Sulfur mediator TusA; Sulfur transfer protein TusA; tRNA 2-thiouridine synthesizing protein A from Escherichia coli O157:H7 (see paper)
83% identity, 96% coverage: 1:80/83 of query aligns to 1:80/81 of P0A892
D3RPC0 Sulfur carrier protein TusA from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) (Chromatium vinosum) (see paper)
35% identity, 89% coverage: 6:79/83 of query aligns to 2:75/76 of D3RPC0
>IAI46_00835
MTDLFAQADQTLDALGLRCPEPVMMVRKTVRHMDNGETLLIIADDPATTRDIPGFCRFME
HTLVAQETEKTPYRYLLRKGVER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory