Comparing IAI47_12665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
6h4nv Ribosome hibernation promoting factor (see paper)
78% identity, 100% coverage: 1:55/55 of query aligns to 1:55/55 of 6h4nv
>IAI47_12665
MKRQKRDRLERAHSRGYQAGITGRSKEMCPYQLIDAKSHWLGGWRQAMEDRSVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory