Comparing MCAODC_24440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P0ACG4 Toxic protein HokC; Protein Gef from Escherichia coli (strain K12) (see paper)
80% identity, 71% coverage: 20:69/70 of query aligns to 1:50/50 of P0ACG4
>MCAODC_24440
MNGKSRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEV
AVFTAYEPEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory