Comparing MMP_RS03535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
2xiuA High resolution structure of mtsl-tagged cylr2. (see paper)
45% identity, 93% coverage: 3:64/67 of query aligns to 4:65/66 of 2xiuA
>MMP_RS03535
MKNKIKVFRAMHNLTQENLAKKLNVTRQTIIAIEKEKYDPSLELAFKIAELFEAKIEDVF
IYESTQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory