SitesBLAST
Comparing N515DRAFT_0011 FitnessBrowser__Dyella79:N515DRAFT_0011 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 49% coverage: 17:227/435 of query aligns to 37:244/444 of Q8NLB7
- D54 (≠ E34) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D37) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R89) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 69% coverage: 84:384/435 of query aligns to 63:382/446 of A0A0H2VG78
- R102 (= R131) mutation to A: Loss of transport activity.
- I105 (≠ Q134) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E151) mutation to A: Loss of transport activity.
- Q137 (≠ Y166) mutation to A: Loss of transport activity.
- Q250 (= Q267) mutation to A: Loss of transport activity.
- Q251 (≠ K268) mutation to A: Loss of transport activity.
- N256 (= N272) mutation to A: Loss of transport activity.
- W357 (≠ A358) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 36% coverage: 78:234/435 of query aligns to 98:260/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 49% coverage: 21:233/435 of query aligns to 29:224/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 34% coverage: 78:225/435 of query aligns to 203:346/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 39% coverage: 78:248/435 of query aligns to 217:394/742 of Q02563
- 321:331 (vs. 189:194, 36% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 196:200 mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 71% coverage: 74:380/435 of query aligns to 186:499/616 of P36035
- K338 (vs. gap) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
27% identity, 34% coverage: 78:225/435 of query aligns to 203:346/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 71% coverage: 68:375/435 of query aligns to 55:342/403 of P77589
- D75 (= D88) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (= A301) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R305) mutation to D: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 27 E→A: Lack of 3HPP transport activity.; E→D: Slight decrease in 3HPP transport activity.
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
30% identity, 29% coverage: 68:193/435 of query aligns to 69:183/493 of P32037
Sites not aligning to the query:
- 43 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
22% identity, 64% coverage: 88:365/435 of query aligns to 100:409/512 of Q6PXP3
- I302 (≠ T263) mutation to S: Does not affect glucose or fructose transport.; mutation to V: Abolished fructose transport.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 34% coverage: 89:236/435 of query aligns to 108:247/514 of Q9LT15
- E162 (= E151) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (≠ L174) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ V181) mutation to A: Reduces affinity for glucose 3-fold.
Sites not aligning to the query:
- 39 F→A: Reduces affinity for glucose 8-fold.
- 43 L→A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- 77 modified: Disulfide link with 449; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- 295 binding
- 296 binding
- 301 binding
- 332 binding
- 344 D→N: Abolishes glucose transport activity; when associated with Q-162.
- 410 binding
- 449 modified: Disulfide link with 77; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
28% identity, 34% coverage: 89:236/435 of query aligns to 88:227/487 of 7aaqA
Sites not aligning to the query:
5eqiA Human glut1 in complex with cytochalasin b (see paper)
26% identity, 62% coverage: 68:336/435 of query aligns to 63:355/447 of 5eqiA
Sites not aligning to the query:
5eqhA Human glut1 in complex with inhibitor (2~{s})-3-(2-bromophenyl)-2-[2- (4-methoxyphenyl)ethanoylamino]-~{n}-[(1~{s})-1- phenylethyl]propanamide (see paper)
26% identity, 62% coverage: 68:336/435 of query aligns to 63:355/447 of 5eqhA
Sites not aligning to the query:
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
27% identity, 34% coverage: 89:236/435 of query aligns to 93:232/485 of 7aarA
Sites not aligning to the query:
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
25% identity, 65% coverage: 54:336/435 of query aligns to 57:363/492 of P17809
Sites not aligning to the query:
- 45 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
29% identity, 32% coverage: 68:205/435 of query aligns to 69:189/496 of P11169
Sites not aligning to the query:
- 277:279 Important for selectivity against fructose; QLS→HVA: Confers moderate fructose transport activity.
- 280:281 binding
- 286 binding
- 315 binding
- 378 binding
- 386 binding
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
29% identity, 32% coverage: 68:205/435 of query aligns to 67:187/469 of 7crzA
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: 26, 66, 278, 279, 284, 313, 375, 384, 411, 412, 415
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
29% identity, 32% coverage: 68:205/435 of query aligns to 69:189/470 of 4zw9A
Sites not aligning to the query:
Query Sequence
>N515DRAFT_0011 FitnessBrowser__Dyella79:N515DRAFT_0011
MNSTTAGLIARAPAMTAGQRLRSIFSGSIGNLVEWYDWYVYSAFSLYFAQVFFPASDQTT
QLLNTSGIFAVGFLMRPLGGWLLGTFADRRGRKAALLLSVFMMSLGSLIIGLSPGYAQIG
VAAPILLVLARLLQGLSIGGEYGTSATYLSEMAPRESRGFWSSIQYVTLVAGQLIALALL
VVLQHFVLSTQQLHDWGWRIPFLIGALLAVIAVIIRRNMDETASFKKARQLESPLRTLMR
HPREVLTVIGLTMGGTLAFYTFTTYMQKFLVNSAGMSKADATSISTAALFVYALLQPAFG
ALSDRIGRRPLLIGFGVLGALLTYPILSTLKEAHDWWQAFGLIMAALIIVSGYTSINAVV
KAELFPTEIRAIGVGLPYALALSVFGGTAEYVALWFKKIGHEDYFYWYVTACIACSLLVY
IGMRDTRRHSRIVED
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory