Comparing N515DRAFT_0011 FitnessBrowser__Dyella79:N515DRAFT_0011 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 49% coverage: 17:227/435 of query aligns to 37:244/444 of Q8NLB7
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 69% coverage: 84:384/435 of query aligns to 63:382/446 of A0A0H2VG78
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 36% coverage: 78:234/435 of query aligns to 98:260/583 of Q9Y7Q9
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 49% coverage: 21:233/435 of query aligns to 29:224/580 of Q9C757
Sites not aligning to the query:
8k77A Synaptic vesicle glycoprotein 2A
27% identity, 39% coverage: 78:248/435 of query aligns to 81:258/592 of 8k77A
Sites not aligning to the query:
8jlhA Cryo-em structure of sv2a dimer in complex with bont/a2 hc and levetiracetam
27% identity, 39% coverage: 78:248/435 of query aligns to 81:258/592 of 8jlhA
Sites not aligning to the query:
8jlcA Synaptic vesicle glycoprotein 2A
27% identity, 39% coverage: 78:248/435 of query aligns to 81:258/592 of 8jlcA
Sites not aligning to the query:
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 34% coverage: 78:225/435 of query aligns to 203:346/727 of Q9Z2I6
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 71% coverage: 74:380/435 of query aligns to 186:499/616 of P36035
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 71% coverage: 68:375/435 of query aligns to 55:342/403 of P77589
Sites not aligning to the query:
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
30% identity, 29% coverage: 68:193/435 of query aligns to 69:183/493 of P32037
Sites not aligning to the query:
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
22% identity, 64% coverage: 88:365/435 of query aligns to 100:409/512 of Q6PXP3
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 34% coverage: 89:236/435 of query aligns to 108:247/514 of Q9LT15
Sites not aligning to the query:
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
28% identity, 34% coverage: 89:236/435 of query aligns to 88:227/487 of 7aaqA
Sites not aligning to the query:
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
27% identity, 34% coverage: 89:236/435 of query aligns to 93:232/485 of 7aarA
Sites not aligning to the query:
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
25% identity, 65% coverage: 54:336/435 of query aligns to 57:363/492 of P17809
Sites not aligning to the query:
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
29% identity, 32% coverage: 68:205/435 of query aligns to 69:189/496 of P11169
Sites not aligning to the query:
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
29% identity, 32% coverage: 68:205/435 of query aligns to 67:187/469 of 7crzA
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
29% identity, 32% coverage: 68:205/435 of query aligns to 69:189/470 of 4zw9A
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
29% identity, 32% coverage: 68:205/435 of query aligns to 66:186/468 of 7spsA
Sites not aligning to the query:
>N515DRAFT_0011 FitnessBrowser__Dyella79:N515DRAFT_0011
MNSTTAGLIARAPAMTAGQRLRSIFSGSIGNLVEWYDWYVYSAFSLYFAQVFFPASDQTT
QLLNTSGIFAVGFLMRPLGGWLLGTFADRRGRKAALLLSVFMMSLGSLIIGLSPGYAQIG
VAAPILLVLARLLQGLSIGGEYGTSATYLSEMAPRESRGFWSSIQYVTLVAGQLIALALL
VVLQHFVLSTQQLHDWGWRIPFLIGALLAVIAVIIRRNMDETASFKKARQLESPLRTLMR
HPREVLTVIGLTMGGTLAFYTFTTYMQKFLVNSAGMSKADATSISTAALFVYALLQPAFG
ALSDRIGRRPLLIGFGVLGALLTYPILSTLKEAHDWWQAFGLIMAALIIVSGYTSINAVV
KAELFPTEIRAIGVGLPYALALSVFGGTAEYVALWFKKIGHEDYFYWYVTACIACSLLVY
IGMRDTRRHSRIVED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory