SitesBLAST
Comparing N515DRAFT_0019 FitnessBrowser__Dyella79:N515DRAFT_0019 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
35% identity, 95% coverage: 11:426/438 of query aligns to 12:412/425 of O59010
- S65 (= S69) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S295) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 295:297) binding
- M311 (= M331) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T334) binding
- V355 (≠ I375) binding
- D394 (= D408) binding
- M395 (= M409) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R411) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N415) binding
- D405 (= D419) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
35% identity, 95% coverage: 11:426/438 of query aligns to 3:403/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
35% identity, 95% coverage: 11:426/438 of query aligns to 9:409/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G73), V83 (≠ A88), I157 (≠ L185), Y164 (≠ L192), K193 (≠ G214), T305 (= T328), I306 (≠ M329), I347 (≠ V370)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L15), M199 (≠ L220), S275 (= S297), T311 (= T334), G356 (≠ S379), L384 (= L401), D391 (= D408), R394 (= R411)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
35% identity, 95% coverage: 11:426/438 of query aligns to 12:412/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L50), F46 (≠ L50), P75 (vs. gap), L91 (= L93), F95 (≠ I100), L130 (= L149), I133 (≠ A152), I159 (= I184), Y167 (≠ L192), K196 (≠ G214), G200 (≠ F218), I207 (≠ V225), F210 (≠ P228), L250 (≠ W268), I262 (≠ F281), M269 (≠ L288), T334 (= T354), V335 (≠ L355), G336 (= G356), T340 (≠ V360), L343 (= L363), M399 (≠ T413)
- binding aspartic acid: S277 (= S296), S278 (= S297), T314 (= T334), G354 (= G374), A358 (≠ G378), G359 (≠ S379), D394 (= D408), R397 (= R411), T398 (= T412)
- binding sodium ion: Y89 (≠ F91), T92 (≠ F94), S93 (≠ A95), G306 (= G326), T308 (= T328), N310 (= N330), N310 (= N330), M311 (= M331), D312 (≠ S332), S349 (≠ A369), I350 (≠ V370), T352 (≠ V372), N401 (= N415), V402 (= V416), D405 (= D419)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
35% identity, 95% coverage: 11:426/438 of query aligns to 4:404/408 of 6bauA
- binding cysteine: S270 (= S297), M303 (= M331), T306 (= T334), A345 (= A373), G346 (= G374), V347 (≠ I375), G351 (≠ S379), D386 (= D408), C389 (≠ R411), T390 (= T412), N393 (= N415)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
35% identity, 95% coverage: 11:426/438 of query aligns to 4:404/409 of 6bavA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
35% identity, 95% coverage: 10:426/438 of query aligns to 10:409/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ G214), G195 (≠ F218), R282 (≠ A306)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S295), S272 (= S296), S273 (= S297), M307 (= M331), T310 (= T334), G353 (= G377), A354 (≠ G378), R394 (= R411), T395 (= T412)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
35% identity, 95% coverage: 10:426/438 of query aligns to 13:412/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
35% identity, 95% coverage: 10:426/438 of query aligns to 13:412/427 of 5e9sA
- binding aspartic acid: R274 (≠ S295), S275 (= S296), S276 (= S297), T313 (= T334), G353 (= G374), V354 (≠ I375), A357 (≠ G378), G358 (≠ S379), D394 (= D408), R397 (= R411), T398 (= T412)
- binding decyl-beta-d-maltopyranoside: L194 (≠ G214), G198 (≠ F218), Y202 (≠ L222)
- binding sodium ion: Y87 (≠ F94), T90 (≠ N97), S91 (≠ M98), S276 (= S297), G305 (= G326), A306 (= A327), T307 (= T328), N309 (= N330), N309 (= N330), M310 (= M331), D311 (≠ S332), S348 (≠ A369), I349 (≠ V370), G350 (≠ A371), T351 (≠ V372), N401 (= N415), V402 (= V416), D405 (= D419)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
35% identity, 95% coverage: 10:426/438 of query aligns to 11:410/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
35% identity, 95% coverage: 10:426/438 of query aligns to 6:401/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S295), S265 (= S297), M299 (= M331), T302 (= T334), T340 (≠ V372), G342 (= G374), V343 (≠ I375), G347 (≠ S379), D383 (= D408), R386 (= R411), T387 (= T412), N390 (= N415)
- binding decyl-beta-d-maltopyranoside: H23 (≠ Q30), V212 (≠ L243), A216 (≠ S247)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
34% identity, 95% coverage: 11:426/438 of query aligns to 4:392/396 of 6bmiA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
27% identity, 86% coverage: 51:426/438 of query aligns to 56:456/503 of Q10901
- N177 (= N160) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ R170) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 90% coverage: 32:427/438 of query aligns to 43:399/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (vs. gap), G89 (= G81), G92 (= G84), A95 (≠ T90), V96 (≠ F91), Y99 (≠ F94), M163 (≠ I184), F167 (≠ A188), F293 (= F321), V297 (≠ L325)
- binding aspartic acid: S268 (= S296), S269 (= S297), T306 (= T334), G346 (= G374), I347 (= I375), A350 (≠ G378), G351 (≠ S379), D380 (= D408), R383 (= R411), T384 (= T412)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
29% identity, 92% coverage: 19:419/438 of query aligns to 15:412/433 of 8cv2A
- binding sodium ion: Y85 (≠ F94), T88 (≠ N97), T89 (≠ M98), G319 (= G326), A320 (= A327), N323 (= N330), N323 (= N330), M324 (= M331), D325 (≠ S332), N408 (= N415), D412 (= D419)
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
29% identity, 84% coverage: 51:419/438 of query aligns to 79:467/532 of P43007
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (= E210) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ M409) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
29% identity, 86% coverage: 51:427/438 of query aligns to 79:475/532 of O35874
- N201 (≠ D169) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ G174) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
29% identity, 86% coverage: 51:426/438 of query aligns to 39:395/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S69), L58 (= L70), L65 (= L77), V339 (= V370), G340 (≠ A371), S343 (≠ G374), I344 (= I375)
- binding cholesterol: W188 (≠ R221), I227 (≠ A258), F250 (= F281), W257 (≠ L288), M379 (≠ L410), S382 (≠ T413)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S297), M300 (= M331), T303 (= T334), Y306 (≠ F337), G348 (≠ S379), L349 (= L380), M352 (≠ I383), I366 (= I397), L369 (≠ V400), V370 (≠ L401), D373 (= D404), D377 (= D408), R380 (= R411), T381 (= T412), N384 (= N415)
Sites not aligning to the query:
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
28% identity, 89% coverage: 32:419/438 of query aligns to 27:394/416 of 8cuaA
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
28% identity, 89% coverage: 32:419/438 of query aligns to 24:391/406 of 8ctcA
- binding glutamic acid: S268 (= S296), S269 (= S297), M303 (= M331), T306 (= T334), G346 (= G374), A350 (≠ G378), D380 (= D408), R383 (= R411)
- binding sodium ion: Y82 (≠ F94), T85 (≠ N97), T86 (≠ M98), S269 (= S297), G298 (= G326), A299 (= A327), T300 (= T328), N302 (= N330), N302 (= N330), M303 (= M331), D304 (≠ S332), S341 (≠ A369), I342 (≠ V370), G343 (≠ A371), A344 (≠ V372), N387 (= N415), D391 (= D419)
Query Sequence
>N515DRAFT_0019 FitnessBrowser__Dyella79:N515DRAFT_0019
MSTPNRLATRILQGLLIGVVAAIATLAIGQFHPATLKTMQAFATAVLDPLGQVFLRLLFF
VVIPLVFASLASGVAQLGRLGRLGPLAARTFALFAANMLIAVAIGLLMMNLLQPGHQLEP
GSRERLLQEYGGGAHRAMERRQQQPDMSLATAVDMFMPRNLLGAFVGHDRGALGDVLPLI
LFAILVGAAATLLDEDKRLKLQSGLDLLSELMTGIVGFALRLAPVAVPAMIYSVIVKIGT
GVLLTLSVFTAGCALALALHLFGSLSLWLRLLARRSPLAYFRQIRPVLITAFSTSSSSAT
LPASLALARDELRLRPSTAGFVLPLGATMNMSGTALFEGCVVLFVAQAFGVDLTLGQQCV
LMLLAVLSAVAVAGIPGGSLPLIAGLLATFGVPPEGIGLVLGVDRILDMLRTTVNVGSDL
VTATVVDAGAVRGDHADA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory