Comparing N515DRAFT_0037 FitnessBrowser__Dyella79:N515DRAFT_0037 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
64% identity, 97% coverage: 14:399/400 of query aligns to 15:400/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
64% identity, 97% coverage: 14:399/400 of query aligns to 12:397/398 of P0AB77
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
63% identity, 97% coverage: 14:399/400 of query aligns to 11:396/396 of 3tqxA
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
60% identity, 96% coverage: 18:399/400 of query aligns to 18:399/400 of 7v58B
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
61% identity, 100% coverage: 1:399/400 of query aligns to 1:399/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
61% identity, 100% coverage: 1:399/400 of query aligns to 1:399/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
61% identity, 100% coverage: 1:399/400 of query aligns to 1:399/399 of 7bxqA
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
57% identity, 97% coverage: 14:399/400 of query aligns to 34:418/419 of Q0P5L8
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
43% identity, 98% coverage: 8:399/400 of query aligns to 9:397/398 of 7poaA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
36% identity, 95% coverage: 15:395/400 of query aligns to 15:391/392 of 3a2bA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
36% identity, 95% coverage: 15:395/400 of query aligns to 15:391/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
36% identity, 95% coverage: 15:395/400 of query aligns to 15:391/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
36% identity, 95% coverage: 15:395/400 of query aligns to 15:391/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
36% identity, 95% coverage: 15:395/400 of query aligns to 15:391/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
36% identity, 95% coverage: 15:395/400 of query aligns to 15:391/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
36% identity, 95% coverage: 15:395/400 of query aligns to 15:391/394 of 8guhA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
37% identity, 89% coverage: 44:398/400 of query aligns to 285:636/653 of Q5W264
Sites not aligning to the query:
2x8uA Sphingomonas wittichii serine palmitoyltransferase (see paper)
36% identity, 93% coverage: 30:399/400 of query aligns to 33:398/399 of 2x8uA
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
35% identity, 87% coverage: 49:396/400 of query aligns to 194:547/587 of P08680
Sites not aligning to the query:
Q93UV0 Serine palmitoyltransferase; SPT; EC 2.3.1.50 from Sphingomonas paucimobilis (Pseudomonas paucimobilis) (see 4 papers)
36% identity, 93% coverage: 30:400/400 of query aligns to 54:420/420 of Q93UV0
Sites not aligning to the query:
>N515DRAFT_0037 FitnessBrowser__Dyella79:N515DRAFT_0037
MSYPDTTQARYAAELDSIREQGLFKAERVIVSPQSAQIELEGGRRVLNFCANNYLGLADH
PQVIQAAKEALDSHGFGMASVRFICGTQDLHKQLEKKIAEFFGTEDTILYAACFDANGGL
YEPLLGEEDAIISDALNHASIIDGIRLCKARRFRYANCDMADLEQQLQAADAAGARTKLI
TTDGAFSMDGFIAPLDKIAALAAKYNAMVHIDECHCTGFLGASGRGSAEVNGVMDKIDIF
TGTLGKALGGALGGFTTGRAEVIELLRQRSRPYLFSNSLPPHVVAAALKVFDMLSSAGEL
RQRVQENTRYFREQMTQAGFDIKPGVHPIVPVMIYDAKKAQAMATRLLDEGIYVTGFFYP
VVPQGQARIRTQMSAAHTREHLDRAIAAFTKVGRELGVIG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory