Comparing N515DRAFT_0067 FitnessBrowser__Dyella79:N515DRAFT_0067 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
70% identity, 94% coverage: 18:268/268 of query aligns to 7:257/257 of P0AAH0
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 90% coverage: 22:263/268 of query aligns to 3:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 92% coverage: 22:267/268 of query aligns to 4:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 92% coverage: 22:267/268 of query aligns to 4:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 92% coverage: 22:267/268 of query aligns to 4:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 92% coverage: 22:267/268 of query aligns to 4:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 90% coverage: 24:264/268 of query aligns to 4:237/240 of 4ymuJ
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 83% coverage: 41:263/268 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 83% coverage: 41:263/268 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
36% identity, 83% coverage: 41:263/268 of query aligns to 46:259/260 of 7ahdC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 86% coverage: 34:263/268 of query aligns to 18:241/343 of P30750
Sites not aligning to the query:
7fc9A Crystal structure of cmabcb1 in lipidic mesophase revealed by lcp-sfx (see paper)
37% identity, 77% coverage: 37:243/268 of query aligns to 361:564/584 of 7fc9A
Sites not aligning to the query:
6a6mA Crystal structure of an outward-open nucleotide-bound state of the eukaryotic abc multidrug transporter cmabcb1 (see paper)
37% identity, 77% coverage: 37:243/268 of query aligns to 361:564/589 of 6a6mA
Sites not aligning to the query:
3wmgA Crystal structure of an inward-facing eukaryotic abc multidrug transporter g277v/a278v/a279v mutant in complex with an cyclic peptide inhibitor, acap (see paper)
37% identity, 77% coverage: 37:243/268 of query aligns to 360:563/589 of 3wmgA
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 86% coverage: 34:263/268 of query aligns to 19:242/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 86% coverage: 34:263/268 of query aligns to 19:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 86% coverage: 34:263/268 of query aligns to 19:242/344 of 3tuiC
Sites not aligning to the query:
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
36% identity, 81% coverage: 36:253/268 of query aligns to 22:235/280 of Q5M244
6q81A Structure of p-glycoprotein(abcb1) in the post-hydrolytic state (see paper)
30% identity, 82% coverage: 37:255/268 of query aligns to 960:1172/1182 of 6q81A
Sites not aligning to the query:
3g61A Structure of p-glycoprotein reveals a molecular basis for poly- specific drug binding (see paper)
30% identity, 82% coverage: 37:255/268 of query aligns to 960:1172/1182 of 3g61A
Sites not aligning to the query:
>N515DRAFT_0067 FitnessBrowser__Dyella79:N515DRAFT_0067
MTESAAAGIHPQPAAALAPTKLRVRDLNFYYNGFHALKGINMDIPEKKVTAIIGPSGCGK
STLLRIFNRIYAIYPKLEAKGEIMLDEENILDTRYSMNKLRSKVGMVFQKPVPFPMTIFE
NVAYGIRHHERLSRADMEIRVEQALRSAALWDEVKDKLKQNALGLSGGQQQRLCIARGIA
LKPEVLLLDEPTSALDPIATGRIEQLVEELKSEYTIVIVTHNMQQAARCSDLTAFMYLGE
LIEFDRTEQIFTKPGKKQTEDYITGRFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory