Comparing N515DRAFT_0084 FitnessBrowser__Dyella79:N515DRAFT_0084 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
4dfdA Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex
24% identity, 91% coverage: 2:188/206 of query aligns to 5:197/205 of 4dfdA
Q9HZ62 N-acetylmuramic acid 6-phosphate phosphatase; MurNAc 6-phosphate phosphatase; MurNAc-6P phosphatase; EC 3.1.3.105 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
24% identity, 87% coverage: 2:181/206 of query aligns to 6:186/226 of Q9HZ62
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
27% identity, 50% coverage: 79:180/206 of query aligns to 92:191/231 of Q51645
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
27% identity, 50% coverage: 79:181/206 of query aligns to 92:192/226 of 2no5B
Sites not aligning to the query:
2b0cA The crystal structure of the putative phosphatase from escherichia coli
21% identity, 93% coverage: 6:196/206 of query aligns to 6:198/199 of 2b0cA
P0A8Y3 Alpha-D-glucose 1-phosphate phosphatase YihX; Alpha-D-glucose-1-P phosphatase; Alpha-D-glucose-1-phosphatase; Haloacid dehalogenase-like phosphatase 4; HAD4; EC 3.1.3.10 from Escherichia coli (strain K12)
21% identity, 93% coverage: 6:196/206 of query aligns to 4:196/199 of P0A8Y3
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
32% identity, 43% coverage: 97:185/206 of query aligns to 98:186/215 of 4ygrA
Sites not aligning to the query:
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
25% identity, 98% coverage: 5:205/206 of query aligns to 4:215/241 of 4knvA
2fdrA Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. C58
25% identity, 90% coverage: 3:188/206 of query aligns to 3:188/222 of 2fdrA
3r09A Crystal structure of probable had family hydrolase from pseudomonas fluorescens pf-5 with bound mg
35% identity, 46% coverage: 86:180/206 of query aligns to 70:165/197 of 3r09A
Sites not aligning to the query:
5mwaA Human seh phosphatase in complex with 3-4-3,4-dichlorophenyl-5-phenyl- 1,3-oxazol-2-yl-benzoic-acid (see paper)
27% identity, 45% coverage: 97:188/206 of query aligns to 106:193/209 of 5mwaA
Sites not aligning to the query:
8wbtA Crystal structure of cis-epoxysuccinate hydrolases klcesh[l] mutant d48n complexed with l-ta (see paper)
26% identity, 67% coverage: 43:180/206 of query aligns to 62:195/237 of 8wbtA
Sites not aligning to the query:
4uauA Crystal structure of cbby (mutant d10n) from rhodobacter sphaeroides in complex with xylulose-(1,5)bisphosphate, crystal form ii (see paper)
26% identity, 90% coverage: 1:186/206 of query aligns to 1:196/226 of 4uauA
P95649 Protein CbbY; RuCbby; EC 3.1.3.- from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
26% identity, 90% coverage: 1:186/206 of query aligns to 1:196/230 of P95649
4uasA Crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate (see paper)
26% identity, 90% coverage: 1:186/206 of query aligns to 1:196/225 of 4uasA
P80299 Bifunctional epoxide hydrolase 2; EC 3.3.2.10; EC 3.1.3.76 from Rattus norvegicus (Rat) (see paper)
27% identity, 41% coverage: 95:179/206 of query aligns to 110:198/554 of P80299
Sites not aligning to the query:
>N515DRAFT_0084 FitnessBrowser__Dyella79:N515DRAFT_0084
MIDTVVFDLGGVLIDWNPRYLYRQLFDDEAAMEHFLTKICTGPWNEQQDAGRPWSEAIAR
LSAEHPAHAPLIAAFRERWEEMLAGPIAGSVELLAELKARGVRLYALTNWSNETFPRALE
LYDFLHWFEGIVVSGEERLIKPDPRIYQCLFERYGVEPSRALYIDDARRNVDAAAALGMQ
AWWFQGAEGLRTWLASHGLVDDKATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory