SitesBLAST
Comparing N515DRAFT_0109 FitnessBrowser__Dyella79:N515DRAFT_0109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
62% identity, 100% coverage: 1:342/342 of query aligns to 1:337/337 of P23247
- C132 (= C134) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
63% identity, 98% coverage: 7:342/342 of query aligns to 4:336/336 of 2r00C
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
52% identity, 96% coverage: 9:337/342 of query aligns to 7:340/346 of Q04797
- S98 (= S100) modified: Phosphoserine
- Y146 (≠ A150) modified: Phosphotyrosine
8jusA Crystal structure of aspartate semialdehyde dehydrogenase from porphyromonas gingivalis complexed with 2',5'adenosine diphosphate
50% identity, 97% coverage: 8:338/342 of query aligns to 2:330/335 of 8jusA
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G78), T94 (= T99), S95 (= S100), R98 (= R103), N126 (= N133), C127 (= C134), Q154 (= Q161), G158 (= G165), K222 (= K218), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), T75 (≠ V80), N93 (= N98), T94 (= T99), P125 (= P132), N126 (= N133), C127 (= C134), G160 (= G167), M161 (≠ R168), G328 (= G325)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (= T99), S95 (= S100), R98 (= R103), N126 (= N133), C127 (= C134), Q154 (= Q161), G158 (= G165), E219 (= E215), K222 (= K218), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), T75 (≠ V80), N93 (= N98), T94 (= T99), N126 (= N133), C127 (= C134), G160 (= G167), M161 (≠ R168), G328 (= G325)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R103), G158 (= G165), E219 (= E215), K222 (= K218), R244 (= R240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), T75 (≠ V80), C127 (= C134), S157 (= S164), G158 (= G165), G160 (= G167), M161 (≠ R168), N324 (= N321), L325 (≠ I322)
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G77), S73 (≠ G78), T94 (= T99), S95 (= S100), R98 (= R103), K222 (= K218)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), T75 (≠ V80), N93 (= N98), T94 (= T99), N126 (= N133), C127 (= C134), G160 (= G167), G328 (= G325)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S75), G72 (= G77), S73 (≠ G78), N93 (= N98), T94 (= T99), S95 (= S100), R98 (= R103), K222 (= K218)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), A71 (= A76), G160 (= G167), M161 (≠ R168), G162 (≠ S169)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 4r3nA
- active site: C127 (= C134), Q154 (= Q161), R244 (= R240), H251 (= H247)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ G78), T94 (= T99), S95 (= S100), R98 (= R103), N126 (= N133), K222 (= K218)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), N93 (= N98), T94 (= T99), N126 (= N133), C127 (= C134), G160 (= G167), M161 (≠ R168), G328 (= G325)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R103), N126 (= N133), G158 (= G165), I208 (= I204), E219 (= E215), K222 (= K218), R244 (= R240)
- binding adenosine-2'-5'-diphosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), A71 (= A76), T75 (≠ V80), G160 (= G167), M161 (≠ R168)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), A71 (= A76), T75 (≠ V80), G160 (= G167)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R103), N126 (= N133), G158 (= G165), A159 (= A166), E219 (= E215), K222 (= K218), R244 (= R240)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 2gz3A
- active site: C127 (= C134), Q154 (= Q161), R244 (= R240), H251 (= H247)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C134), Q154 (= Q161), G158 (= G165), E219 (= E215), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), T75 (≠ V80), N93 (= N98), G158 (= G165), G160 (= G167), M161 (≠ R168), N324 (= N321), A329 (= A326)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 2gz2A
- active site: C127 (= C134), Q154 (= Q161), R244 (= R240), H251 (= H247)
- binding adenosine-2'-5'-diphosphate: G8 (= G13), T10 (= T15), G11 (= G16), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), A71 (= A76), T75 (≠ V80)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/357 of 2gz1A
- active site: C127 (= C134), Q154 (= Q161), R244 (= R240), H251 (= H247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), T75 (≠ V80), N93 (= N98), S157 (= S164), G158 (= G165), G160 (= G167), M161 (≠ R168), N324 (= N321), L325 (≠ I322)
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A35 (= A40), S36 (= S41), R38 (= R43), S39 (= S44), T56 (≠ L61), A71 (= A76), T75 (≠ V80), G160 (= G167), M161 (≠ R168), G162 (≠ S169)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R103), N126 (= N133), C127 (= C134), Q154 (= Q161), G158 (= G165), E219 (= E215), K222 (= K218), R244 (= R240)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), T10 (= T15), G11 (= G16), A12 (= A17), V13 (= V18), A35 (= A40), S36 (= S41), S39 (= S44), T56 (≠ L61), S70 (= S75), A71 (= A76), G72 (= G77), N93 (= N98), T94 (= T99), N126 (= N133), C127 (= C134), G160 (= G167), M161 (≠ R168), G328 (= G325)
- binding phthalic acid: S73 (≠ G78), T94 (= T99), S95 (= S100), R98 (= R103), N126 (= N133), K222 (= K218)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
47% identity, 97% coverage: 7:339/342 of query aligns to 2:342/361 of 3pylC
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
43% identity, 97% coverage: 7:337/342 of query aligns to 2:340/342 of 3tz6A
- active site: C129 (= C134), Q156 (= Q161), R248 (= R240), H255 (= H247)
- binding cysteine: C129 (= C134), Q156 (= Q161), G160 (= G165), E223 (= E215), R248 (= R240), H255 (= H247)
- binding glycerol: S108 (= S113), G187 (≠ V187), F192 (= F192), P201 (≠ Q195), Q225 (≠ M217), R228 (≠ V220), F229 (≠ W221), Q335 (= Q332), E338 (= E335), L339 (≠ R336)
- binding sulfate ion: R98 (= R103), H117 (≠ R122), R119 (≠ T124), N128 (= N133), C129 (= C134), K226 (= K218), E270 (≠ G262), R273 (= R265)
Query Sequence
>N515DRAFT_0109 FitnessBrowser__Dyella79:N515DRAFT_0109
MSKKSSYKVAMVGATGAVGETLLAILAERKFPVGELVPLASERSAGGKVDFAGKSVTVRN
LADYDFTGVDIAFFSAGGSVSREHAPRAAAAGAVVIDNTSEFRYQDDIPLVVSEVNPHAI
ARYTVRGIIANPNCSTMQMLVALAPIHRQAGIERINVATYQSVSGAGRSGMEELGKQTAA
LLNFQDVERSKFPKQIAFNVIPHIDDFQDNGYTKEEMKMVWETRKILEDETIQVNPTAVR
VPVFYGHSEAVHIETRDKITAGQARALLEKAEGVVVQDERKAGGYPTPVGDAAGKDPVFV
GRIREDISHERGLDLWIVSDNIRKGAALNAVQIAERLIEDYL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory