Comparing N515DRAFT_0142 FitnessBrowser__Dyella79:N515DRAFT_0142 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8U8Z6 Imidazolonepropionase; Imidazolone-5-propanoate hydrolase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
54% identity, 97% coverage: 9:407/410 of query aligns to 18:417/419 of Q8U8Z6
2puzB Crystal structure of imidazolonepropionase from agrobacterium tumefaciens with bound product n-formimino-l-glutamate (see paper)
54% identity, 99% coverage: 3:407/410 of query aligns to 2:403/404 of 2puzB
2gokA Crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution (see paper)
54% identity, 99% coverage: 3:407/410 of query aligns to 2:403/404 of 2gokA
2q09A Crystal structure of imidazolonepropionase from environmental sample with bound inhibitor 3-(2,5-dioxo-imidazolidin-4-yl)-propionic acid (see paper)
57% identity, 90% coverage: 24:393/410 of query aligns to 21:386/402 of 2q09A
2oofA The crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample
57% identity, 90% coverage: 24:393/410 of query aligns to 22:387/403 of 2oofA
A0KF84 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) (see paper)
57% identity, 90% coverage: 24:393/410 of query aligns to 27:394/411 of A0KF84
2bb0A Structure of imidazolonepropionase from bacillus subtilis (see paper)
39% identity, 93% coverage: 22:404/410 of query aligns to 28:407/413 of 2bb0A
P42084 Imidazolonepropionase; Imidazolone-5-propionate hydrolase; EC 3.5.2.7 from Bacillus subtilis (strain 168) (see paper)
39% identity, 93% coverage: 22:404/410 of query aligns to 30:409/421 of P42084
2g3fA Crystal structure of imidazolonepropionase complexed with imidazole-4- acetic acid sodium salt, a substrate homologue (see paper)
39% identity, 93% coverage: 22:404/410 of query aligns to 29:408/414 of 2g3fA
6sj4A Amidohydrolase, ahs with substrate analog (see paper)
27% identity, 97% coverage: 9:407/410 of query aligns to 5:448/494 of 6sj4A
6sj3A Amidohydrolase, ahs with 3-hba (see paper)
27% identity, 97% coverage: 9:407/410 of query aligns to 5:448/494 of 6sj3A
6sj2B Amidohydrolase, ahs with 3-haa (see paper)
27% identity, 97% coverage: 9:407/410 of query aligns to 14:457/503 of 6sj2B
8ihsA Cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 in complex with ochratoxin a (see paper)
25% identity, 82% coverage: 43:378/410 of query aligns to 19:371/399 of 8ihsA
8ihrA Cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 in complex with phe (see paper)
25% identity, 82% coverage: 43:378/410 of query aligns to 19:371/399 of 8ihrA
8ihqA Cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 (see paper)
25% identity, 82% coverage: 43:378/410 of query aligns to 19:371/399 of 8ihqA
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
25% identity, 88% coverage: 27:385/410 of query aligns to 21:367/428 of 3hpaA
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
26% identity, 38% coverage: 230:385/410 of query aligns to 230:400/474 of Q9EYU0
Sites not aligning to the query:
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
27% identity, 58% coverage: 168:405/410 of query aligns to 138:405/436 of 4f0rA
Sites not aligning to the query:
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
27% identity, 58% coverage: 168:405/410 of query aligns to 138:405/434 of 4f0sA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
29% identity, 35% coverage: 264:407/410 of query aligns to 249:408/437 of 4dykA
Sites not aligning to the query:
>N515DRAFT_0142 FitnessBrowser__Dyella79:N515DRAFT_0142
MNTASWDLLLTGATLATFDGGQPYGLIEDGALAMAGGRIAWIGPRAQLPADAQARAASVE
HLDGALVTPGLVDCHTHLVFGGDRAHEFDLRLNGASYEEIARAGGGIASTVKATREADED
ELFTQALPRARALLADGVTTLEIKSGYGLELESERRMLRVARRLGEALGIGVRTSFLGLH
ALPAEYREDRDGYVALVCDRILPALAAEGLVDAVDAFCEGIGFTREETRRVFERARSLGL
PVKLHAEQLSNLEGAALVAEYDGLSADHLEYLSEDGVRAMAAKGTVAVLLPGAFYALRET
KLPPIAALREHGVAMAVATDCNPGTSPLLSLRLAAGMACTLFRLTPEEALRGVTVHAARA
LGLDDRGTLAVGQRADLVVWQVQRPAELCYWIGGGLVRAVYCGGRRIETA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory