SitesBLAST
Comparing N515DRAFT_0211 FitnessBrowser__Dyella79:N515DRAFT_0211 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
30% identity, 99% coverage: 1:336/338 of query aligns to 1:343/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (≠ W43), H59 (= H59), E60 (= E60), C89 (≠ D89), C92 (= C92), C95 (= C95), C103 (≠ V104), G107 (≠ F108), D152 (= D146), T156 (= T150), K340 (= K333)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (= S40), T156 (= T150), G178 (= G172), P179 (≠ A173), V180 (= V174), D200 (≠ S194), R201 (= R195), R205 (= R199), A243 (≠ C238), V244 (= V239), V266 (= V261), V268 (= V263), L292 (≠ P285), A293 (= A286), F333 (≠ M326)
- binding zinc ion: C38 (= C38), H59 (= H59), C89 (≠ D89), C92 (= C92), C95 (= C95), C103 (≠ V104), D152 (= D146)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
31% identity, 97% coverage: 1:328/338 of query aligns to 5:331/348 of 5ylnA
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
31% identity, 84% coverage: 1:283/338 of query aligns to 4:288/342 of 4ejmA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (≠ W43), H61 (= H59), E62 (= E60), C91 (≠ D89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (≠ E107), P147 (≠ V147), C151 (≠ G151)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G170), G172 (= G172), V173 (≠ A173), I174 (≠ V174), T194 (≠ S194), R195 (= R195), Q196 (≠ H196), K199 (≠ R199), C240 (= C238), E245 (= E243), T246 (≠ S244), L263 (≠ V261), V265 (= V263)
- binding zinc ion: C91 (≠ D89), C94 (= C92), C97 (= C95), C105 (= C103)
Sites not aligning to the query:
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
31% identity, 84% coverage: 1:283/338 of query aligns to 4:288/343 of 4ej6A
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (≠ W43), H61 (= H59), E62 (= E60), C91 (≠ D89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (≠ E107), P147 (≠ V147), C151 (≠ G151)
- binding zinc ion: C91 (≠ D89), C94 (= C92), C97 (= C95), C105 (= C103)
Sites not aligning to the query:
3fsrA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of t. Brockii adh by c. Beijerinckii adh (see paper)
29% identity, 96% coverage: 15:338/338 of query aligns to 17:347/352 of 3fsrA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (≠ W43), H59 (= H59), E60 (= E60), D89 (= D89), T92 (≠ C92), V95 (≠ C95), S103 (≠ C103), D150 (= D146), T154 (= T150), K346 (≠ Q337)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D146)
3fpcA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. Brockii adh by e. Histolytica adh (see paper)
27% identity, 96% coverage: 15:338/338 of query aligns to 17:347/352 of 3fpcA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (≠ W43), H59 (= H59), E60 (= E60), D89 (= D89), T92 (≠ C92), V95 (≠ C95), S103 (≠ C103), D150 (= D146), T154 (= T150), K346 (≠ Q337)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D146)
1kevA Structure of NADP-dependent alcohol dehydrogenase (see paper)
29% identity, 97% coverage: 1:329/338 of query aligns to 1:340/351 of 1kevA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (≠ W43), H59 (= H59), E60 (= E60), D89 (= D89), S92 (≠ C92), V95 (≠ C95), S103 (vs. gap), D150 (= D146), T154 (= T150)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T38 (≠ G39), D150 (= D146), I175 (≠ D171), G176 (= G172), V178 (= V174), S199 (≠ R195), R200 (≠ H196), Y218 (≠ E214), A242 (≠ C238), G244 (= G240), N266 (≠ G262), Y267 (≠ V263), K340 (≠ R329)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D146)
Sites not aligning to the query:
P25984 NADP-dependent isopropanol dehydrogenase; CbADH; EC 1.1.1.80 from Clostridium beijerinckii (Clostridium MP) (see 3 papers)
29% identity, 97% coverage: 1:329/338 of query aligns to 1:340/351 of P25984
6schC Nadh-dependent variant of cbadh (see paper)
29% identity, 97% coverage: 1:329/338 of query aligns to 1:340/355 of 6schC
- active site: C37 (= C38), S39 (= S40), H42 (≠ W43), H59 (= H59), D150 (= D146)
- binding nicotinamide-adenine-dinucleotide: T38 (≠ G39), W110 (≠ C103), D150 (= D146), T154 (= T150), G174 (= G170), V178 (= V174), D198 (≠ S194), Y199 (≠ R195), R200 (≠ H196), A242 (≠ C238), G243 (≠ V239), G244 (= G240), N266 (≠ G262), Y267 (≠ V263), K340 (≠ R329)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D146)
P80360 Alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Myxine glutinosa (Atlantic hagfish) (see 2 papers)
28% identity, 100% coverage: 1:337/338 of query aligns to 3:375/376 of P80360
Sites not aligning to the query:
- 1 modified: N-acetylserine
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
29% identity, 96% coverage: 15:338/338 of query aligns to 18:340/344 of 7xy9A
- binding magnesium ion: H101 (≠ Q100), H103 (≠ S102), H158 (≠ Y153), C288 (≠ A286), G290 (≠ V288), G291 (≠ R289), L293 (≠ Y291), R294 (vs. gap)
- binding zinc ion: C38 (= C38), H60 (= H59), E61 (= E60), D151 (= D146)
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
29% identity, 96% coverage: 15:338/338 of query aligns to 15:345/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D146), T152 (= T150), G172 (= G170), I173 (≠ D171), G174 (= G172), P175 (≠ A173), V176 (= V174), R198 (≠ H196), G242 (= G240), V263 (= V261), N264 (≠ G262), Y265 (≠ V263), C293 (≠ A286)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (= S40), H57 (= H59), W108 (≠ R106), D148 (= D146)
- binding zinc ion: C35 (= C38), H57 (= H59), E58 (= E60), D148 (= D146)
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
29% identity, 96% coverage: 15:338/338 of query aligns to 17:347/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (= S40), H59 (= H59), A85 (≠ F85), W110 (≠ R106), D150 (= D146), C295 (≠ A286)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C38), T38 (≠ G39), S39 (= S40), D150 (= D146), T154 (= T150), G174 (= G170), G176 (= G172), P177 (≠ A173), V178 (= V174), S199 (≠ R195), R200 (≠ H196), A242 (≠ C238), G243 (≠ V239), G244 (= G240), I248 (≠ S244), V265 (= V261), N266 (≠ G262), Y267 (≠ V263), C295 (≠ A286), K340 (≠ R329)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D146)
7f3pD Crystal structure of a NADP-dependent alcohol dehydrogenase mutant in apo form (see paper)
29% identity, 96% coverage: 15:338/338 of query aligns to 20:350/355 of 7f3pD
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
29% identity, 96% coverage: 15:338/338 of query aligns to 17:347/352 of 1ykfA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (≠ W43), H59 (= H59), E60 (= E60), D89 (= D89), T92 (≠ C92), V95 (≠ C95), S103 (≠ C103), D150 (= D146), T154 (= T150), K346 (≠ Q337)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S40), D150 (= D146), T154 (= T150), G174 (= G170), I175 (≠ D171), G176 (= G172), P177 (≠ A173), V178 (= V174), S199 (≠ R195), R200 (≠ H196), Y218 (≠ E214), I223 (≠ G219), N266 (≠ G262), Y267 (≠ V263)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D146)
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
29% identity, 96% coverage: 15:338/338 of query aligns to 17:347/352 of 1bxzB
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (≠ W43), H59 (= H59), E60 (= E60), D89 (= D89), T92 (≠ C92), V95 (≠ C95), S103 (≠ C103), D150 (= D146), T154 (= T150), K346 (≠ Q337)
- binding 2-butanol: H59 (= H59), D150 (= D146)
P14941 NADP-dependent isopropanol dehydrogenase; EC 1.1.1.80 from Thermoanaerobacter brockii (Thermoanaerobium brockii) (see 2 papers)
29% identity, 96% coverage: 15:338/338 of query aligns to 17:347/352 of P14941
1h2bB Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution (see paper)
27% identity, 90% coverage: 1:304/338 of query aligns to 1:312/344 of 1h2bB
- active site: C39 (= C38), H40 (≠ G39), T41 (≠ S40), H44 (≠ W43), H64 (= H59), E65 (= E60), D94 (= D89), C97 (= C92), C100 (= C95), C108 (= C103), E112 (= E107), D153 (≠ S144), T157 (≠ L148)
- binding nicotinamide-adenine-dinucleotide (acidic form): C39 (= C38), H40 (≠ G39), T41 (≠ S40), H44 (≠ W43), T157 (≠ L148), V180 (≠ D171), G181 (= G172), G182 (≠ A173), L183 (≠ V174), D203 (≠ S194), V204 (≠ R195), K208 (≠ R199), F246 (≠ C238), V247 (= V239), T252 (≠ S244), Y255 (≠ Q247), V269 (= V261), G270 (= G262), Y271 (≠ V263), L293 (≠ P285), V294 (≠ A286)
- binding octanoic acid (caprylic acid): T41 (≠ S40), W50 (vs. gap), H64 (= H59), D153 (≠ S144), V294 (≠ A286)
- binding zinc ion: C39 (= C38), H64 (= H59), D94 (= D89), C97 (= C92), C100 (= C95), C108 (= C103), D153 (≠ S144)
Sites not aligning to the query:
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
28% identity, 97% coverage: 1:329/338 of query aligns to 1:340/351 of 3fplA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (≠ W43), H59 (= H59), E60 (= E60), D89 (= D89), S92 (≠ C92), V95 (≠ C95), S103 (vs. gap), D150 (= D146), T154 (= T150)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D146)
Sites not aligning to the query:
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
29% identity, 76% coverage: 5:262/338 of query aligns to 7:270/357 of 7y9pA
Query Sequence
>N515DRAFT_0211 FitnessBrowser__Dyella79:N515DRAFT_0211
MKGTVLHGPNDIRFEEVPEPKIEKPTDAIIRIAVTCVCGSDLWPYRGISPGSGPTRMGHE
YCGYVEEVGSAVMAIKKGQFVVGSFATSDNTCPTCNIGYQSSCVQREFVSQAQSPYLRVA
HADGTLVATREAPDASMVPGLLASSDVLGTGWYAADAARVRPGVTAVVVGDGAVGLLAVL
SAKQMGAERIIVMSRHPARQKLALDFGATDIVAERGEEGVARIMELTRGLGADSVLECVG
TGESMQQAMRVTRKGGHMSFVGVPHGVEIEGQALFFSHIHLEGGPAPVRRYLPDLIDLIL
DQKIDPSAVFDLVLPLDQVAEGYKAMDERRAIKALLQP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory