Comparing N515DRAFT_0360 FitnessBrowser__Dyella79:N515DRAFT_0360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
51% identity, 96% coverage: 14:364/364 of query aligns to 1:351/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
50% identity, 95% coverage: 14:358/364 of query aligns to 4:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
49% identity, 96% coverage: 14:362/364 of query aligns to 3:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
47% identity, 93% coverage: 14:353/364 of query aligns to 3:320/320 of 7xntC
1t47A Structure of fe2-hppd bound to ntbc (see paper)
38% identity, 78% coverage: 77:360/364 of query aligns to 73:362/362 of 1t47A
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
32% identity, 90% coverage: 21:346/364 of query aligns to 296:611/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
30% identity, 90% coverage: 21:346/364 of query aligns to 294:614/635 of Q88JU3
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
31% identity, 82% coverage: 62:358/364 of query aligns to 45:344/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
31% identity, 82% coverage: 62:358/364 of query aligns to 46:346/357 of O52791
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
35% identity, 54% coverage: 168:364/364 of query aligns to 177:381/393 of Q02110
Sites not aligning to the query:
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
29% identity, 84% coverage: 60:364/364 of query aligns to 53:373/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
29% identity, 83% coverage: 60:362/364 of query aligns to 55:373/374 of 8im2A
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 84% coverage: 60:364/364 of query aligns to 61:381/393 of P32755
Sites not aligning to the query:
7yvvA Acmp1, r-4-hydroxymandelate synthase
29% identity, 80% coverage: 69:358/364 of query aligns to 57:334/335 of 7yvvA
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
28% identity, 82% coverage: 60:358/364 of query aligns to 55:369/371 of 8im3A
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
29% identity, 87% coverage: 41:358/364 of query aligns to 23:342/343 of 3zgjB
1sqiA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
28% identity, 80% coverage: 60:349/364 of query aligns to 54:343/343 of 1sqiA
1sqiB Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
28% identity, 80% coverage: 60:349/364 of query aligns to 55:342/342 of 1sqiB
P93836 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 76% coverage: 81:355/364 of query aligns to 131:432/445 of P93836
5yy6A Crystal structure of arabidopsis thaliana hppd truncated mutant complexed with benquitrione (see paper)
28% identity, 76% coverage: 81:355/364 of query aligns to 97:371/371 of 5yy6A
>N515DRAFT_0360 FitnessBrowser__Dyella79:N515DRAFT_0360
MSAQPNLGMQVTTFENPMGIDGFEFVEFAAPAGRGAELHELFGSMGFTAVLKHKRRPITV
YRQGGVNFLVNEDPDSFAAEFAAQHGPCAAGFAIRFKQPAAEVYAKVLANGGEAVGDKEA
SKAVDAPVVKGIGDCMLYLVDRYGDKGSIYDGDYAPIPGVEQNPAGFGLTFIDHLTHNLY
FGNMQKWSDYYERLFNFREIRYFDIKGAKTGLVSKAMTAPDGIVRIPLNESSDPKSQINE
YLDAYHGEGIQHIACFTDNIYETVEAMRAKGVSFLDTPDTYFDVIDLRIPNHGEDVPRLA
RNKILIDADPETKQRKLLQIFTQNNIGPIFFEIIQRKGNEGFGEGNFQALFESIERDQMR
RGVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory