Comparing N515DRAFT_0362 FitnessBrowser__Dyella79:N515DRAFT_0362 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
55% identity, 99% coverage: 1:325/328 of query aligns to 7:340/343 of 3lzkC
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
25% identity, 60% coverage: 110:307/328 of query aligns to 94:268/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
25% identity, 60% coverage: 110:307/328 of query aligns to 94:268/290 of 8gsrA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
25% identity, 69% coverage: 40:265/328 of query aligns to 19:226/265 of 3r6oA
>N515DRAFT_0362 FitnessBrowser__Dyella79:N515DRAFT_0362
MKLGSLKEGGRDGTLIVVSRDLSRAVKATGIAATLQAALDDWSNLAPRLNALYGELQAGT
APDAFALDVAAMAAPLPRAYEFVDGSAYLPHVERVRRARGAEVPESFYVDPLMYQATSAG
FLAPRDPVLVPSEDYGIDLEAEVVVITDDVPMAATPAQASAHIQLVGLVNDVSLRGLIPA
ELAKGFGFLQSKPRSALSPVFVTPDELGDVWREDKLHLPMRTWINGAWFGEAECGVDMQF
SFAQLVAHAAKTRPLTAGTIVGSGTIANEDTGKGASCLAEQRTVETLRDGQPSTPFLKYG
DVIRIDVTDGDGASIFGAIEQRIASPSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory