SitesBLAST
Comparing N515DRAFT_0379 FitnessBrowser__Dyella79:N515DRAFT_0379 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5kf0A Crystal structure of an aldedhyde dehydrogenase from burkholderia vietnamiensis
65% identity, 100% coverage: 1:474/476 of query aligns to 4:478/480 of 5kf0A
- active site: N157 (= N154), K180 (= K177), E252 (= E248), C288 (= C284), E382 (= E378), E460 (= E456)
- binding magnesium ion: E88 (≠ Y85)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I153 (= I150), S154 (≠ T151), P155 (= P152), F156 (= F153), N157 (= N154), L162 (= L159), K180 (= K177), S183 (≠ E180), R184 (= R181), R213 (≠ G210), T231 (= T228), G232 (= G229), S233 (= S230), V236 (≠ I232), E252 (= E248), L253 (= L249), C288 (= C284), E382 (= E378), F384 (= F380)
Sites not aligning to the query:
5j6bA Crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with NADPH
67% identity, 100% coverage: 1:474/476 of query aligns to 5:479/481 of 5j6bA
- active site: N158 (= N154), K181 (= K177), E253 (= E248), C289 (= C284), E383 (= E378), E461 (= E456)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I154 (= I150), S155 (≠ T151), P156 (= P152), F157 (= F153), N158 (= N154), L163 (= L159), K181 (= K177), A183 (= A179), S184 (≠ E180), R214 (≠ G210), T232 (= T228), G233 (= G229), S234 (= S230), V237 (≠ I232), L241 (= L236), E253 (= E248), L254 (= L249), C289 (= C284), E383 (= E378), F385 (= F380), Y450 (= Y445)
5n5sB Crystal structure of aldehyde dehydrogenase 21 (aldh21) from physcomitrella patens in complex with NADP+ (see paper)
53% identity, 99% coverage: 4:474/476 of query aligns to 4:476/481 of 5n5sB
- active site: N155 (= N154), K178 (= K177), E251 (= E248), C286 (= C284), E380 (= E378), E458 (= E456)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V151 (≠ I150), S152 (≠ T151), P153 (= P152), W154 (≠ F153), N155 (= N154), L160 (= L159), K178 (= K177), A180 (= A179), S181 (≠ E180), R212 (≠ G210), A215 (= A213), T230 (= T228), G231 (= G229), S232 (= S230), I235 (= I232), E251 (= E248), L252 (= L249), C286 (= C284), E380 (= E378), F382 (= F380), Y447 (= Y445)
3rhdA Crystal structure of glyceraldehyde-3-phosphate dehydrogenase gapn from methanocaldococcus jannaschii dsm 2661 complexed with NADP
38% identity, 95% coverage: 21:473/476 of query aligns to 6:454/456 of 3rhdA
- active site: N133 (= N154), H156 (≠ K177), E233 (= E248), C267 (= C284), E360 (= E378), E437 (= E456)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I129 (= I150), T130 (= T151), F132 (= F153), H156 (≠ K177), S158 (≠ A179), S159 (≠ E180), K160 (≠ R181), G193 (= G210), E194 (≠ K211), G197 (vs. gap), D198 (≠ S214), F211 (= F227), S214 (= S230), V217 (≠ I232)
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
36% identity, 95% coverage: 21:473/476 of query aligns to 28:480/482 of P25526
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
36% identity, 95% coverage: 21:473/476 of query aligns to 27:479/481 of 3jz4A
- active site: N156 (= N154), K179 (= K177), E254 (= E248), C288 (= C284), E385 (= E378), E462 (= E456)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P152), W155 (≠ F153), K179 (= K177), A181 (= A179), S182 (≠ E180), A212 (vs. gap), G216 (≠ A213), G232 (= G229), S233 (= S230), I236 (= I232), C288 (= C284), K338 (≠ R334), E385 (= E378), F387 (= F380)
8hapB Crystal structure of thermostable acetaldehyde dehydrogenase from hyperthermophilic archaeon sulfolobus tokodaii (see paper)
36% identity, 90% coverage: 47:473/476 of query aligns to 29:463/466 of 8hapB
- binding 2'-monophosphoadenosine-5'-diphosphate: I136 (= I150), L137 (≠ T151), F139 (= F153), K163 (= K177), S165 (≠ A179), I166 (≠ E180), S196 (≠ D209), G200 (≠ A213), G216 (= G229), S217 (= S230), T220 (≠ I232), I224 (≠ L236)
8hapA Crystal structure of thermostable acetaldehyde dehydrogenase from hyperthermophilic archaeon sulfolobus tokodaii (see paper)
36% identity, 90% coverage: 47:473/476 of query aligns to 29:463/466 of 8hapA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: I136 (= I150), L137 (≠ T151), F139 (= F153), K163 (= K177), S165 (≠ A179), I166 (≠ E180), S196 (≠ D209), G200 (≠ A213), G216 (= G229), S217 (= S230), T220 (≠ I232), I224 (≠ L236), L239 (= L249), C272 (= C284), E368 (= E378), F370 (= F380)
O14293 Putative aldehyde dehydrogenase-like protein C9E9.09c; EC 1.2.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 90% coverage: 40:469/476 of query aligns to 55:491/503 of O14293
- S248 (= S230) modified: Phosphoserine
Sites not aligning to the query:
- 501 modified: Phosphoserine
8c54A Cryo-em structure of nadh bound sla dehydrogenase rlgabd from rhizobium leguminosarum bv. Trifolii srd1565
36% identity, 99% coverage: 5:473/476 of query aligns to 3:479/482 of 8c54A
- binding 1,4-dihydronicotinamide adenine dinucleotide: I152 (= I150), T153 (= T151), P154 (= P152), K179 (= K177), A212 (≠ G210), K213 (= K211), F230 (= F227), T231 (= T228), G232 (= G229), S233 (= S230), V236 (≠ I232), W239 (= W234), G256 (= G250)
Q59931 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]; Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase; Triosephosphate dehydrogenase; EC 1.2.1.9 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see 3 papers)
33% identity, 99% coverage: 2:473/476 of query aligns to 1:472/475 of Q59931
- R103 (= R104) binding
- S151 (≠ T151) binding
- K177 (= K177) binding
- T180 (≠ E180) binding
- D215 (≠ P215) binding
- 230:251 (vs. 229:249, 41% identical) binding
- E377 (= E378) binding
- R437 (≠ F438) binding
2esdA Crystal structure of thioacylenzyme intermediate of an NADP dependent aldehyde dehydrogenase (see paper)
33% identity, 99% coverage: 4:473/476 of query aligns to 2:471/474 of 2esdA
- active site: N153 (= N154), K176 (= K177), A249 (≠ E248), C283 (= C284), E376 (= E378), Q454 (≠ E456)
- binding glyceraldehyde-3-phosphate: R102 (= R104), Y154 (≠ F155), R282 (≠ S283), C283 (= C284), T284 (≠ I285), Q435 (≠ S437), R436 (≠ F438)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F152 (= F153), K176 (= K177), P178 (≠ A179), T179 (≠ E180), G209 (= G210), G213 (≠ S214), D214 (≠ P215), F227 (= F227), S230 (= S230), I233 (= I232), K328 (≠ A330), S329 (≠ A331), Y332 (≠ R334)
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
34% identity, 90% coverage: 42:469/476 of query aligns to 42:480/497 of P17202
- D96 (≠ E90) binding
- SPW 156:158 (≠ TPF 151:153) binding
- Y160 (≠ F155) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-(trimethylamino)butanal.
- W167 (≠ H162) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- KPSE 182:185 (≠ KPAE 177:180) binding
- L186 (≠ R181) binding
- SSAT 236:239 (≠ SQ-I 230:232) binding
- V251 (vs. gap) binding in other chain
- L258 (= L249) binding
- W285 (≠ Y278) mutation to A: Decreases binding affinity for betaine aldehyde.
- E390 (= E378) binding
- A441 (≠ G429) mutation to I: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- C450 (≠ S437) mutation to S: Loss of partial inactivation by betaine aldehyde in the absence of NAD(+).
- W456 (≠ Y445) binding ; mutation to A: Decreases binding affinity for betaine aldehyde.
- K460 (= K449) binding
Sites not aligning to the query:
1qi1B Ternary complex of an NADP dependent aldehyde dehydrogenase (see paper)
33% identity, 99% coverage: 4:473/476 of query aligns to 2:471/474 of 1qi1B
- active site: N153 (= N154), K176 (= K177), E249 (= E248), S283 (≠ C284), E376 (= E378), Q454 (≠ E456)
- binding sn-glycerol-3-phosphate: Y154 (≠ F155), R282 (≠ S283), S283 (≠ C284), T284 (≠ I285), R436 (≠ F438)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P151 (= P152), F152 (= F153), N153 (= N154), L158 (= L159), K176 (= K177), P178 (≠ A179), T179 (≠ E180), G209 (= G210), G213 (≠ S214), G229 (= G229), S230 (= S230), I233 (= I232), E249 (= E248), L250 (= L249), S283 (≠ C284)
6tgwA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with a selective inhibitor (see paper)
33% identity, 92% coverage: 38:474/476 of query aligns to 43:477/478 of 6tgwA
- active site: N155 (= N154), E254 (= E248), C288 (= C284), E459 (= E456)
- binding methyl 5-(1,3-benzodioxol-5-yl)-2-phenyl-pyrazolo[1,5-a]pyrimidine-7-carboxylate: I106 (vs. gap), G110 (≠ R104), F156 (= F155), Q278 (≠ F274), F282 (≠ Y278), L442 (≠ F438), A444 (≠ V440)
- binding nicotinamide-adenine-dinucleotide: I151 (= I150), T152 (= T151), P153 (= P152), W154 (≠ F153), K178 (= K177), G211 (= G210), G215 (≠ S214), F229 (= F227), G231 (= G229), S232 (= S230), V235 (≠ I232)
4v37A Crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with 3-aminopropionaldehyde
33% identity, 90% coverage: 42:469/476 of query aligns to 40:478/495 of 4v37A
- active site: N157 (= N154), K180 (= K177), E255 (= E248), A289 (≠ C284), E388 (= E378), E465 (= E456)
- binding 3-aminopropan-1-ol: C448 (≠ S437), W454 (≠ Y445)
- binding nicotinamide-adenine-dinucleotide: I153 (= I150), S154 (≠ T151), P155 (= P152), W156 (≠ F153), N157 (= N154), M162 (≠ L159), K180 (= K177), S182 (≠ A179), E183 (= E180), G213 (= G210), G217 (vs. gap), A218 (≠ S214), T232 (= T228), G233 (= G229), S234 (= S230), T237 (≠ I232), E255 (= E248), L256 (= L249), A289 (≠ C284), E388 (= E378), F390 (= F380)
7a6qB Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
33% identity, 92% coverage: 38:474/476 of query aligns to 51:488/489 of 7a6qB
- active site: N163 (= N154), E262 (= E248), C296 (= C284), E470 (= E456)
- binding nicotinamide-adenine-dinucleotide: I159 (= I150), W162 (≠ F153), K186 (= K177), E189 (= E180), G219 (= G210), G223 (≠ S214), S240 (= S230), V243 (≠ I232), K342 (≠ A330)
- binding (3-oxidanylidene-3-sodiooxy-propanoyl)oxysodium: D103 (≠ E90), E189 (= E180), Q190 (≠ R181), F218 (≠ D209), I339 (= I327), D340 (= D328)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ R104), D141 (≠ E127), N143 (≠ G134), N451 (≠ P436), L453 (≠ F438), A455 (≠ V440)
Sites not aligning to the query:
7a6qA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
33% identity, 92% coverage: 38:474/476 of query aligns to 51:488/489 of 7a6qA
- active site: N163 (= N154), E262 (= E248), C296 (= C284), E470 (= E456)
- binding nicotinamide-adenine-dinucleotide: I159 (= I150), T160 (= T151), W162 (≠ F153), K186 (= K177), A188 (= A179), E189 (= E180), G219 (= G210), G223 (≠ S214), S240 (= S230), V243 (≠ I232), K342 (≠ A330), K346 (≠ R334)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ R104), D141 (≠ E127), N143 (≠ G134), N451 (≠ P436), L453 (≠ F438), Y454 (≠ R439)
5fhzA Human aldehyde dehydrogenase 1a3 complexed with NAD(+) and retinoic acid (see paper)
33% identity, 92% coverage: 38:474/476 of query aligns to 51:488/489 of 5fhzA
- active site: N163 (= N154), K186 (= K177), E262 (= E248), C296 (= C284), E393 (= E378), E470 (= E456)
- binding nicotinamide-adenine-dinucleotide: I159 (= I150), T160 (= T151), W162 (≠ F153), K186 (= K177), E189 (= E180), G219 (= G210), G223 (≠ S214), F237 (= F227), G239 (= G229), S240 (= S230), T241 (vs. gap), V243 (≠ I232), G264 (= G250), Q343 (≠ A331), E393 (= E378)
- binding retinoic acid: G118 (≠ R104), R121 (≠ E107), F164 (= F155), M168 (≠ L159), W171 (≠ H162), C295 (≠ S283), C296 (= C284), L453 (≠ F438)
7qk9A Crystal structure of the aldh1a3-atp complex (see paper)
33% identity, 92% coverage: 38:474/476 of query aligns to 50:487/489 of 7qk9A
- binding adenosine-5'-triphosphate: I158 (= I150), T159 (= T151), P160 (= P152), W161 (≠ F153), K185 (= K177), E188 (= E180), G218 (= G210), G222 (≠ S214), F236 (= F227), S239 (= S230), V242 (≠ I232)
Query Sequence
>N515DRAFT_0379 FitnessBrowser__Dyella79:N515DRAFT_0379
MLEKKYPYYLANKAQTSKAWMDVLDKYSGKVATRVAVPDAKATEQAIAAAVKAAEPMRQF
KPWERQAVLQHCVQRFTERRDELAYALCVEAGKPIKDSAGEVTRLIETFGIAAEEAVRTN
GETINLEIAKRLNGYHGYTRRVPLGPVSFITPFNFPLNLVAHKVAPAIAAGCPFVLKPAE
RTPIGALIIGEVLAETDLPKGAFSILNLDGKHASPLVEDPRFKLLSFTGSQIGWDLKTRA
GHKKVTLELGGNAACIVDADQLPRLDHVIERLVFGAFYQSGQSCISVQRIYAHESLYDEL
KKRLVAAVKGLKAGDPKKKETFLGPMIDEAAAERLHGWIEEARKGGGKVLCGGKRKGPML
EATLMENVRGDAKVNRQEVFGPFALLAPFKSLDEAIAMTNDSDYGLQAGIFTDSLANAMR
AWNELEQGGVIVNDVPSFRVDNMPYGGVKLSGAGREGVRYAIEDMTEIRLMVMRES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory