Comparing N515DRAFT_0391 FitnessBrowser__Dyella79:N515DRAFT_0391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
58% identity, 95% coverage: 3:327/341 of query aligns to 13:326/340 of Q47898
Sites not aligning to the query:
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
62% identity, 84% coverage: 40:327/341 of query aligns to 3:281/295 of 1p4vA
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
62% identity, 84% coverage: 40:327/341 of query aligns to 1:279/293 of 4r4yA
2gl9B Crystal structure of glycosylasparaginase-substrate complex (see paper)
68% identity, 37% coverage: 202:327/341 of query aligns to 2:130/144 of 2gl9B
Sites not aligning to the query:
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
39% identity, 85% coverage: 42:331/341 of query aligns to 28:336/346 of P20933
Sites not aligning to the query:
P30919 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Rattus norvegicus (Rat) (see paper)
40% identity, 74% coverage: 42:294/341 of query aligns to 28:298/345 of P30919
Sites not aligning to the query:
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
37% identity, 74% coverage: 31:282/341 of query aligns to 10:249/308 of Q7L266
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
37% identity, 74% coverage: 31:282/341 of query aligns to 11:241/300 of 4osxA
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
36% identity, 74% coverage: 31:282/341 of query aligns to 11:239/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
36% identity, 74% coverage: 31:282/341 of query aligns to 11:236/295 of 4o0hA
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 74% coverage: 61:312/341 of query aligns to 42:286/321 of P37595
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
32% identity, 72% coverage: 87:330/341 of query aligns to 63:282/298 of 4o48A
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
29% identity, 59% coverage: 62:261/341 of query aligns to 76:300/420 of Q9H6P5
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
42% identity, 33% coverage: 201:312/341 of query aligns to 1:108/135 of 2zalB
1apzB Human aspartylglucosaminidase complex with reaction product (see paper)
45% identity, 28% coverage: 201:294/341 of query aligns to 1:94/141 of 1apzB
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
42% identity, 33% coverage: 201:312/341 of query aligns to 1:108/135 of 8c23DDD
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
33% identity, 40% coverage: 201:337/341 of query aligns to 1:132/133 of 2gezB
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
28% identity, 59% coverage: 62:261/341 of query aligns to 36:207/313 of 2a8jB
Sites not aligning to the query:
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
40% identity, 30% coverage: 61:164/341 of query aligns to 41:141/158 of 1jn9A
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
40% identity, 30% coverage: 61:164/341 of query aligns to 41:141/156 of 8c0iAAA
Sites not aligning to the query:
>N515DRAFT_0391 FitnessBrowser__Dyella79:N515DRAFT_0391
MADRRRFLKTAALGVTAAALSSRIAPALADGKAAGMSGGRKPRVISTWDFGVPANLAAWA
VLAKGGRALDAVEAGVMIPEADLKNHSVGRAGYPDRDGHVSLDASIMDGDGSCGAVAALE
GIAHPIQVARRVMERTPHVLLVGEGAQQFAVEQGFKKEKLLTPESEKAWHEWLKTAHYQP
SANSEVRDYGKGAGGKDNHDTIGMLAIDAQGRLAGACTTSGMAWKLRGRVGDSPIIGAGL
YVDGEVGGATSTGVGEEVIRNAGSFLVVELMRQGRSPQQACEEAVMRIVKKRPQAAKDLQ
VGFLAINREGEVGAFAIQSGFSYAVCDGAKQDGLFPSKSVY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory