SitesBLAST
Comparing N515DRAFT_0396 FitnessBrowser__Dyella79:N515DRAFT_0396 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozbA Crystal structure of 5'-methylthioinosine phosphorylase from psedomonas aeruginosa in complex with hypoxanthine (see paper)
52% identity, 97% coverage: 6:245/247 of query aligns to 5:240/241 of 3ozbA
- active site: T10 (≠ S11), P33 (≠ T34), F56 (≠ V60), P57 (= P61), A83 (= A87), M182 (= M186), T183 (= T187), N206 (= N210), A208 (= A212), M218 (≠ I223)
- binding hypoxanthine: A83 (= A87), V84 (= V88), G85 (= G89), L163 (= L167), E164 (= E168), V180 (= V184), G181 (= G185), M182 (= M186), N206 (= N210)
Q8U2I1 6-oxopurine nucleoside phosphorylase; Purine nucleoside phosphorylase; PNP; PfPNP; EC 2.4.2.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
42% identity, 98% coverage: 5:245/247 of query aligns to 4:245/265 of Q8U2I1
- C136 (≠ T135) modified: Disulfide link with 202
- C162 (≠ A161) modified: Disulfide link with 190
- E169 (= E168) mutation to S: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with D-211, D-213 and A-223.
- C190 (≠ M189) modified: Disulfide link with 162
- C202 (≠ A201) modified: Disulfide link with 136
- N211 (= N210) mutation to D: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with S-169, D-213 and A-223.
- A213 (= A212) mutation to D: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with S-169, D-211 and A-223.
- H223 (≠ I223) mutation to A: Decreases catalytic activity for insosine and allows the enzyme to phosphorolytically cleave MTA with a catalytic efficiency about 4-fold higher than for inosine; when associated with S-169, D-211 and D-213.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 254 modified: Disulfide link with 256; C→S: Fully active, but reduces thermodynamic and kinetic stability of the enzyme; when associated with S-256.
- 256 modified: Disulfide link with 254; C→S: Fully active, but reduces thermodynamic and kinetic stability of the enzyme; when associated with S-254.
Q8U4Q8 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; PfMTAP; EC 2.4.2.28 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
40% identity, 96% coverage: 5:242/247 of query aligns to 4:234/257 of Q8U4Q8
- C130 (≠ T135) modified: Disulfide link with 195
- C195 (≠ A201) modified: Disulfide link with 130
Sites not aligning to the query:
- 246 modified: Disulfide link with 248
- 248 modified: Disulfide link with 246
1wtaA Crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
45% identity, 84% coverage: 5:211/247 of query aligns to 12:218/273 of 1wtaA
Sites not aligning to the query:
4gljA Crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b (see paper)
41% identity, 92% coverage: 4:230/247 of query aligns to 5:232/287 of 4gljA
- active site: D212 (≠ N210), D214 (≠ A212)
- binding N-[9-(2-carboxyphenyl)-6-(diethylamino)-3H-xanthen-3-ylidene]-N-ethylethanaminium: S12 (= S11), Y15 (= Y14), H55 (= H54), A88 (= A87), G90 (= G89), F169 (≠ L167), F169 (≠ L167), I186 (≠ V184), G187 (= G185), M188 (= M186), D212 (≠ N210), F213 (= F211), D214 (≠ A212), N219 (≠ D217), A228 (≠ I226), I229 (≠ F227), L232 (= L230)
3t94A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate (see paper)
39% identity, 98% coverage: 5:246/247 of query aligns to 10:248/270 of 3t94A
- active site: S16 (= S11), P39 (≠ T34), H63 (= H58), I65 (≠ V60), P66 (= P61), A92 (= A87), M190 (= M186), T191 (= T187), D214 (≠ N210), D216 (≠ A212), A225 (≠ I223)
- binding 5'-deoxy-5'-methylthioadenosine: G94 (= G89), F170 (≠ L167), I188 (≠ V184), M190 (= M186), D214 (≠ N210), A225 (≠ I223), V228 (≠ I226)
Q97W94 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPII; EC 2.4.2.28 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
39% identity, 98% coverage: 5:246/247 of query aligns to 10:248/270 of Q97W94
- C138 (≠ T135) modified: Disulfide link with 205
- C200 (≠ R196) modified: Disulfide link with 262
- C205 (≠ A201) modified: Disulfide link with 138
Sites not aligning to the query:
- 259 modified: Disulfide link with 261; C→S: Reduces thermostability of the enzyme; when associated with S-261.
- 261 modified: Disulfide link with 259; C→S: Reduces thermostability of the enzyme; when associated with S-259.
- 262 modified: Disulfide link with 200; C→S: Reduces thermostability of the enzyme.
6dz0A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
35% identity, 97% coverage: 3:241/247 of query aligns to 4:245/274 of 6dz0A
- active site: T12 (≠ S11), P35 (≠ T34), H59 (= H58), I61 (≠ V60), M62 (≠ P61), A88 (= A87), M190 (= M186), T191 (= T187), D214 (≠ N210), D216 (≠ A212), V227 (≠ I223)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(pent-4-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T12 (≠ S11), H59 (= H58), A88 (= A87), C89 (≠ V88), G90 (= G89), F171 (≠ L167), I188 (≠ V184), N189 (≠ G185), M190 (= M186), T213 (≠ A209), D214 (≠ N210), D216 (≠ A212), V227 (≠ I223), V230 (≠ I226)
- binding phosphate ion: G11 (= G10), T12 (≠ S11), R54 (= R53), H55 (= H54), T87 (≠ N86), T191 (= T187)
6dz3A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
35% identity, 97% coverage: 3:241/247 of query aligns to 2:243/273 of 6dz3A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (≠ A212), V225 (≠ I223)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-butyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: T84 (≠ V85), A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), I186 (≠ V184), N187 (≠ G185), M188 (= M186), D212 (≠ N210), D214 (≠ A212), V228 (≠ I226), L232 (= L230)
6dyzA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
35% identity, 97% coverage: 3:241/247 of query aligns to 2:243/273 of 6dyzA
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (≠ A212), V225 (≠ I223)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(prop-2-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S11), H57 (= H58), A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), I186 (≠ V184), N187 (≠ G185), M188 (= M186), D212 (≠ N210), D214 (≠ A212), V228 (≠ I226)
- binding phosphate ion: G9 (= G10), T10 (≠ S11), R52 (= R53), H53 (= H54), T85 (≠ N86), A86 (= A87), T189 (= T187)
5tc8A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with methylthio-dadme-immucillin-a
35% identity, 97% coverage: 3:241/247 of query aligns to 2:243/273 of 5tc8A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (≠ A212), V225 (≠ I223)
- binding (3r,4s)-1-[(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol: T10 (≠ S11), A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), I186 (≠ V184), N187 (≠ G185), M188 (= M186), T211 (≠ A209), D212 (≠ N210), D214 (≠ A212), V228 (≠ I226)
5tc6A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
35% identity, 97% coverage: 3:241/247 of query aligns to 2:243/273 of 5tc6A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (≠ A212), V225 (≠ I223)
- binding (2S,3S,4R,5S)-2-(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(propylsulfanyl)methyl]pyrrolidine-3,4-diol: T10 (≠ S11), A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), N187 (≠ G185), M188 (= M186), D212 (≠ N210), V225 (≠ I223), V228 (≠ I226), L229 (≠ F227)
3ozcA Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
35% identity, 97% coverage: 3:241/247 of query aligns to 2:243/273 of 3ozcA
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (≠ A212), V225 (≠ I223)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(4-chlorophenyl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S11), H57 (= H58), A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), I186 (≠ V184), N187 (≠ G185), M188 (= M186), D212 (≠ N210), D214 (≠ A212), V228 (≠ I226), L229 (≠ F227)
5eubA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
35% identity, 97% coverage: 3:241/247 of query aligns to 1:242/272 of 5eubA
- active site: T9 (≠ S11), P32 (≠ T34), H56 (= H58), I58 (≠ V60), M59 (≠ P61), A85 (= A87), M187 (= M186), T188 (= T187), D211 (≠ N210), D213 (≠ A212), V224 (≠ I223)
- binding (2~{R},3~{R},4~{S},5~{S})-2-[2,6-bis(azanyl)purin-9-yl]-5-(methylsulfanylmethyl)oxolane-3,4-diol: A85 (= A87), C86 (≠ V88), G87 (= G89), F168 (≠ L167), I185 (≠ V184), N186 (≠ G185), T210 (≠ A209), D211 (≠ N210), D213 (≠ A212), V227 (≠ I226)
5tc5A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride
35% identity, 97% coverage: 3:241/247 of query aligns to 15:256/286 of 5tc5A
- active site: T23 (≠ S11), P46 (≠ T34), H70 (= H58), I72 (≠ V60), M73 (≠ P61), A99 (= A87), M201 (= M186), T202 (= T187), D225 (≠ N210), D227 (≠ A212), V238 (≠ I223)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(butylsulfanyl)methyl]pyrrolidin-3-ol: A99 (= A87), C100 (≠ V88), G101 (= G89), F182 (≠ L167), I199 (≠ V184), M201 (= M186), D225 (≠ N210), D227 (≠ A212), V241 (≠ I226)
1k27A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue (see paper)
36% identity, 97% coverage: 3:241/247 of query aligns to 2:240/270 of 1k27A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (≠ G214), V222 (≠ I223)
- binding (3s,4r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]pyrrolidine-3,4-diol: A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), N187 (≠ G185), M188 (= M186), D212 (≠ N210), V225 (≠ I226)
- binding phosphate ion: G9 (= G10), T10 (≠ S11), R52 (= R53), H53 (= H54), T85 (≠ N86), A86 (= A87), T189 (= T187)
1sd2A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin (see paper)
36% identity, 93% coverage: 3:231/247 of query aligns to 2:222/262 of 1sd2A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M182 (= M186), T183 (= T187), D206 (≠ N210), D208 (= D217), V214 (≠ I223)
- binding 2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-methylsulfanylmethyl-tetrahydro-furan-3,4-diol: C87 (≠ V88), G88 (= G89), F163 (≠ L167), I180 (≠ V184), N181 (≠ G185), M182 (= M186), D206 (≠ N210), V217 (≠ I226)
1sd1A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a (see paper)
35% identity, 97% coverage: 3:241/247 of query aligns to 2:238/268 of 1sd1A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (= D217), V220 (≠ I223)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), I186 (≠ V184), N187 (≠ G185), M188 (= M186), D212 (≠ N210), D214 (= D217)
1cg6A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-deoxy-5'-methylthioadenosine and sulfate at 1.7 a resolution (see paper)
35% identity, 97% coverage: 3:241/247 of query aligns to 2:238/268 of 1cg6A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (= D217), V220 (≠ I223)
- binding 5'-deoxy-5'-methylthioadenosine: A86 (= A87), C87 (≠ V88), G88 (= G89), F169 (≠ L167), N187 (≠ G185), M188 (= M186), D212 (≠ N210), V223 (≠ I226)
- binding sulfate ion: G9 (= G10), T10 (≠ S11), R52 (= R53), H53 (= H54), T85 (≠ N86), T189 (= T187)
1cb0A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution (see paper)
35% identity, 97% coverage: 3:241/247 of query aligns to 2:238/268 of 1cb0A
- active site: T10 (≠ S11), P33 (≠ T34), H57 (= H58), I59 (≠ V60), M60 (≠ P61), A86 (= A87), M188 (= M186), T189 (= T187), D212 (≠ N210), D214 (= D217), V220 (≠ I223)
- binding adenine: C87 (≠ V88), G88 (= G89), F169 (≠ L167), D212 (≠ N210), D214 (= D217)
Query Sequence
>N515DRAFT_0396 FitnessBrowser__Dyella79:N515DRAFT_0396
MTIDLAVIGGSGLYSFPGLENTTRHGVDTPFGKTSADVVIGDFAGKRVAFLARHGESHGV
PPHRVNYRANLWALHSLGARTVIGVNAVGGIRDDMGPRAIVVPDQVIDYTHGRYTSFCDA
EGAEVKHIDFSEPYTAALRRQLVDAAGQAGIAVIDGGCYGATQGPRLETRAEIARMKRDG
CDLVGMTGMPEAALARELELAYACLALVANFAAGCGDEAEISIDEIFAHLKAATAEVPRI
LEALLKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory