SitesBLAST
Comparing N515DRAFT_0416 FitnessBrowser__Dyella79:N515DRAFT_0416 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
37% identity, 95% coverage: 19:671/686 of query aligns to 13:688/707 of 6yswA
- active site: A66 (= A71), I71 (≠ F76), A84 (≠ Q87), Q88 (= Q93), G112 (= G117), E115 (= E120), P136 (= P141), E137 (= E142), G145 (= G150), D264 (≠ K269), S422 (= S420), H443 (= H441), E455 (= E453), N493 (= N491)
- binding coenzyme a: E23 (≠ S29), M25 (≠ V31), A66 (= A71), D67 (= D72), I68 (= I73), P136 (= P141), E137 (= E142), L140 (= L145), T290 (≠ E295), K293 (= K298)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 95% coverage: 19:673/686 of query aligns to 49:748/763 of P40939
- V282 (= V234) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I254) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ I290) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E453) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
36% identity, 93% coverage: 16:652/686 of query aligns to 14:681/715 of 1wdlA
- active site: A69 (= A71), N89 (≠ I89), N93 (≠ Q93), G117 (= G117), E120 (= E120), P139 (= P141), E140 (= E142), P147 (= P149), G148 (= G150), S430 (= S420), H451 (= H441), E463 (= E453), N501 (= N491)
- binding nicotinamide-adenine-dinucleotide: A322 (= A316), I324 (≠ V318), M325 (= M319), D344 (= D338), I345 (≠ R339), A400 (= A390), V401 (≠ I391), E403 (= E393), N428 (= N418), T429 (= T419), S430 (= S420)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
36% identity, 93% coverage: 16:652/686 of query aligns to 14:681/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
36% identity, 93% coverage: 16:652/686 of query aligns to 14:673/707 of 1wdmA
- active site: A69 (= A71), N89 (≠ I89), N93 (≠ Q93), G117 (= G117), E120 (= E120), P139 (= P141), E140 (= E142), P147 (= P149), G148 (= G150), S430 (= S420), H451 (= H441), E463 (= E453), N501 (= N491)
- binding acetyl coenzyme *a: K142 (≠ M144), D297 (≠ Q294), M459 (= M449), N501 (= N491), P534 (= P524), Y652 (≠ F631), L658 (≠ P637)
- binding nicotinamide-adenine-dinucleotide: G321 (= G315), A322 (= A316), I324 (≠ V318), M325 (= M319), D344 (= D338), V401 (≠ I391), E403 (= E393), N428 (= N418), S430 (= S420), N454 (= N444)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 95% coverage: 16:665/686 of query aligns to 14:690/729 of P21177
- G116 (= G117) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G317) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H441) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
34% identity, 95% coverage: 16:665/686 of query aligns to 14:690/719 of 6tnmA
- active site: A68 (= A71), F73 (= F76), G116 (= G117), E119 (= E120), P138 (= P141), E139 (= E142), G147 (= G150), N271 (≠ K269), S429 (= S420), H450 (= H441), E462 (= E453), N500 (= N491)
- binding adenosine-5'-triphosphate: D343 (= D338), I344 (≠ R339), V400 (≠ I391), V401 (≠ F392), V406 (≠ A397), K584 (= K570)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
30% identity, 97% coverage: 8:671/686 of query aligns to 2:705/711 of 7o4uA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
30% identity, 97% coverage: 8:673/686 of query aligns to 13:725/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G70), G77 (≠ A71), T81 (≠ E75), M82 (≠ F76), M82 (≠ F76), A85 (≠ Y79), D89 (vs. gap), T96 (≠ N88), L123 (≠ M115), G124 (= G116), P149 (= P141), E150 (= E142), S366 (≠ E340), L367 (≠ M341), E368 (≠ K342), A420 (= A390), V421 (≠ I391), F422 (= F392)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
30% identity, 97% coverage: 8:673/686 of query aligns to 13:725/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G70), F169 (≠ I161), N173 (≠ D165), S177 (≠ P168), I193 (≠ L184), F313 (≠ L292)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (≠ L34), N40 (≠ S35), E41 (≠ R36), T81 (≠ E75), D92 (≠ T84), V93 (= V85)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (≠ L34), G77 (≠ A71), D78 (= D72), M82 (≠ F76), V93 (= V85)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ M144), R184 (≠ A175), A311 (≠ I290), F312 (= F291), I673 (≠ A627)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
30% identity, 97% coverage: 8:673/686 of query aligns to 14:726/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (≠ L34), N41 (≠ S35), E42 (≠ R36), G77 (= G70), G78 (≠ A71), D79 (= D72), V80 (≠ I73), D90 (vs. gap), V94 (= V85), L124 (≠ M115), G125 (= G116), P150 (= P141), E151 (= E142)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
30% identity, 97% coverage: 8:673/686 of query aligns to 13:725/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ R36), G76 (= G70), G77 (≠ A71), D78 (= D72), V79 (≠ I73), M82 (≠ F76), D89 (vs. gap), V93 (= V85), T96 (≠ N88), T96 (≠ N88), P149 (= P141), E150 (= E142)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
30% identity, 97% coverage: 8:673/686 of query aligns to 13:725/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (≠ L34), M82 (≠ F76), E150 (= E142), Q172 (≠ L164), F175 (vs. gap), V176 (≠ L167), Q181 (≠ T172), T241 (= T221), F254 (≠ V234), N257 (≠ Q237), Q261 (≠ K241), L262 (≠ V242), P266 (≠ H246), P268 (= P248), Q282 (≠ S262), V283 (vs. gap), G302 (≠ T281), Q303 (≠ S282), V304 (≠ T283), S521 (≠ N491), G525 (≠ M495)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
30% identity, 97% coverage: 8:673/686 of query aligns to 13:725/729 of 8opvA
- binding resveratrol: M39 (≠ L34), A75 (= A68), G76 (= G70), M82 (≠ F76), E128 (= E120), P149 (= P141), E150 (= E142), T152 (≠ M144), L153 (= L145), R184 (≠ A175), F296 (≠ V275)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
30% identity, 97% coverage: 8:673/686 of query aligns to 13:725/729 of 8opuA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
30% identity, 97% coverage: 8:673/686 of query aligns to 12:724/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ A33), N39 (≠ S35), G75 (= G70), D77 (= D72), M81 (≠ F76), V92 (= V85), T95 (≠ N88), P148 (= P141), E149 (= E142), L152 (= L145), Q180 (≠ T172), Q260 (≠ K241), K362 (≠ Q337), D363 (= D338), V364 (≠ R339), V430 (≠ L401), D476 (≠ A447), K477 (≠ Q448), M478 (= M449), P479 (= P450), K506 (= K477)
- binding formamide: V78 (≠ I73), K79 (= K74)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
30% identity, 97% coverage: 8:673/686 of query aligns to 15:727/731 of 4b3iA
- active site: G79 (≠ A71), E100 (= E90), R104 (= R94), G127 (= G117), E130 (= E120), P151 (= P141), E152 (= E142), G160 (= G150), S452 (= S420), H473 (= H441), E485 (= E453), S523 (≠ N491)
- binding adenosine-5'-diphosphate: Q640 (≠ V594), P641 (= P595), P642 (vs. gap), L643 (vs. gap), Q644 (≠ A596)
- binding coenzyme a: T38 (≠ V31), V40 (≠ A33), A77 (= A68), G79 (≠ A71), D80 (= D72), V81 (≠ I73), E152 (= E142), F315 (≠ L292), Q319 (≠ R296)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
30% identity, 97% coverage: 8:673/686 of query aligns to 12:724/727 of 8oqoA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
30% identity, 97% coverage: 8:673/686 of query aligns to 19:731/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (≠ L34), I50 (≠ L39), G82 (= G70), G83 (≠ A71), D84 (= D72), T87 (≠ E75), T87 (≠ E75), M88 (≠ F76), M88 (≠ F76), A91 (≠ Y79), D95 (vs. gap), D98 (≠ T84), V99 (= V85), T102 (≠ N88), T102 (≠ N88), E134 (= E120), E156 (= E142), L159 (= L145), F302 (≠ V275), F302 (≠ V275), F319 (≠ L292), S456 (= S420), T457 (≠ S421), M485 (= M449), P486 (= P450), G523 (= G487), S527 (≠ N491), N535 (≠ L499), P560 (= P524), M575 (≠ C539), I578 (≠ V542), I578 (≠ V542), I682 (= I630), M683 (≠ F631), G686 (= G634)
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
30% identity, 96% coverage: 15:673/686 of query aligns to 14:719/723 of 8oqqA
Query Sequence
>N515DRAFT_0416 FitnessBrowser__Dyella79:N515DRAFT_0416
MFEGLRFNHWKTSLDDSGIVTLTLDRANSSVNALSREVLDELGQIVERLSIEKPAGVLIH
SAKPGGFAVGADIKEFVEYARDGTVLQNIENGQRVFESLARLPCPTVAAIHGACMGGGTE
LVLACRQRIAADDEKTRIGLPEVMLGIHPGWGGTARLPRLIGALDALPVMLTGKALSARR
AAALGVVDRLAPPNELLAEARALLRRPHARPAARRLKAWATNTWPARQILAPMVLKQTAA
KVRKEHYPAPFALINVWQRGGSSIQQRLKLEARSVAKLAETSTARNLIRIFLLQERLKGQ
GSGVEHGIEHVHVVGAGVMGGDIAAWAAFKGFQVTLQDREMKFIQPALDRARALYEKKLK
TPEKVEETARRLRADVEGKGVAAADLAIEAIFENAEAKQALYASIEPQFQADEILATNTS
SIPLDELRRGLKAPQRFLGLHFFNPVAQMPLVEVVRHDGLDPEVEKRALAFCKAIGKLPV
AVKGTPGFLVNRILMPYLLEAIRLYNEGVPGPVLDKEAKKFGMPMGPIELADTVGLDVCA
SVGKELAPFLGLELPPGIEDKLAAGKRGKKDGQGFYVWQEGKPQKPEVDPDYAVPADLQE
RMLLPMVNEAVACLADGVVDDADLLDAGVIFGTGFAPFRGGPIQYVRSEGAAVIKGKLER
LAQRHGERFTPKQGWDLAILAQPPEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory