Comparing N515DRAFT_0434 FitnessBrowser__Dyella79:N515DRAFT_0434 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
45% identity, 99% coverage: 1:252/254 of query aligns to 2:252/252 of 2qedA
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
45% identity, 99% coverage: 1:252/254 of query aligns to 1:251/251 of Q8ZRM2
6rz0A Crystal structure of escherichia coli glyoxalase ii
43% identity, 99% coverage: 1:252/254 of query aligns to 1:251/251 of 6rz0A
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
42% identity, 99% coverage: 1:252/254 of query aligns to 1:254/254 of 2q42A
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
42% identity, 99% coverage: 1:252/254 of query aligns to 71:324/324 of Q9SID3
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
47% identity, 99% coverage: 1:252/254 of query aligns to 3:259/259 of 8ewoA
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 100% coverage: 1:254/254 of query aligns to 1:258/258 of O24496
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
37% identity, 100% coverage: 1:253/254 of query aligns to 1:256/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
37% identity, 100% coverage: 1:253/254 of query aligns to 1:256/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
37% identity, 100% coverage: 1:253/254 of query aligns to 1:256/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
37% identity, 100% coverage: 1:253/254 of query aligns to 49:304/308 of Q16775
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
31% identity, 86% coverage: 3:220/254 of query aligns to 15:259/283 of 2p18A
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
31% identity, 65% coverage: 8:172/254 of query aligns to 10:192/202 of 7l0bA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
31% identity, 53% coverage: 3:137/254 of query aligns to 5:160/210 of 2xf4A
Sites not aligning to the query:
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
32% identity, 64% coverage: 17:178/254 of query aligns to 17:196/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
33% identity, 61% coverage: 25:178/254 of query aligns to 23:194/198 of 2zziA
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
31% identity, 60% coverage: 15:166/254 of query aligns to 15:191/209 of 7ev5A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
32% identity, 63% coverage: 10:168/254 of query aligns to 11:172/225 of 4ysbA
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
25% identity, 78% coverage: 21:217/254 of query aligns to 27:245/336 of 3r2uB
Sites not aligning to the query:
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
26% identity, 77% coverage: 20:215/254 of query aligns to 24:256/473 of 3tp9A
>N515DRAFT_0434 FitnessBrowser__Dyella79:N515DRAFT_0434
MHVVPVPALADNYIWLLYDDAGDAIVVDPGEAAPIEAALDRRGLRLRAILLTHHHNDHIG
GVADLLAHGPVPVYAPRDERIGHVTQAVADGDEVTIAQPSARFRVLEIPGHTRSHIAYVG
AGMLLCGDTLFSMGCGRLFEGTPQQMLASLDRLADLPGELKVCCAHEYTAANGRFAQTVE
PANAALAQRVEQVRALREQAQPTLPVALATERATNPFLRVDNHDVAQWCTRHGAAADRVS
RFAALRAAKDEFRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory