SitesBLAST
Comparing N515DRAFT_0492 FitnessBrowser__Dyella79:N515DRAFT_0492 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
50% identity, 97% coverage: 5:379/386 of query aligns to 7:376/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (= L93), F125 (≠ Y123), S134 (= S132), F234 (= F233), M238 (= M237), Q239 (≠ G238), L241 (= L240), D242 (= D241), R245 (= R244), Y364 (= Y367), E365 (= E368), G366 (= G369)
- binding flavin-adenine dinucleotide: F125 (≠ Y123), L127 (= L125), S128 (≠ T126), G133 (= G131), S134 (= S132), W158 (= W157), T160 (= T159), R270 (= R269), F273 (= F272), L280 (≠ F279), Q338 (= Q341), I339 (= I342), G342 (= G345), I360 (= I363), T367 (= T370), E369 (= E372), I370 (= I373)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
50% identity, 97% coverage: 5:379/386 of query aligns to 34:403/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
51% identity, 96% coverage: 9:379/386 of query aligns to 12:376/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (= M346), T347 (≠ K350), E348 (= E351)
- binding flavin-adenine dinucleotide: F125 (≠ Y123), L127 (= L125), S128 (≠ T126), G133 (= G131), S134 (= S132), W158 (= W157), T160 (= T159), R270 (= R269), F273 (= F272), L280 (≠ F279), V282 (≠ M281), Q338 (= Q341), I339 (= I342), G342 (= G345), I360 (= I363), Y364 (= Y367), T367 (= T370), E369 (= E372), I370 (= I373), L373 (= L376)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
51% identity, 96% coverage: 9:379/386 of query aligns to 15:379/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ Y123), L130 (= L125), S131 (≠ T126), G136 (= G131), S137 (= S132), W161 (= W157), T163 (= T159), T214 (= T210), R273 (= R269), F276 (= F272), L280 (≠ I276), L283 (≠ F279), V285 (≠ M281), Q341 (= Q341), I342 (= I342), G345 (= G345), I363 (= I363), Y367 (= Y367), T370 (= T370), E372 (= E372), L376 (= L376)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
51% identity, 96% coverage: 9:379/386 of query aligns to 39:403/412 of P16219
- G90 (= G61) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E75) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 123:132, 60% identical) binding in other chain
- R171 (≠ N144) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (= WIT 157:159) binding in other chain
- A192 (= A164) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G181) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R269) binding
- Q308 (= Q280) binding in other chain
- R325 (≠ T297) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (= S329) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QIHGG 341:345) binding
- R380 (= R356) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (= TSE 370:372) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
51% identity, 96% coverage: 9:379/386 of query aligns to 9:373/381 of 8sgsA
- binding coenzyme a: S131 (= S132), A133 (= A134), N177 (≠ A179), F231 (= F233), M235 (= M237), L238 (= L240), I312 (≠ G318), E362 (= E368), G363 (= G369)
- binding flavin-adenine dinucleotide: F122 (≠ Y123), L124 (= L125), S125 (≠ T126), G130 (= G131), S131 (= S132), W155 (= W157), T157 (= T159), R267 (= R269), F270 (= F272), L274 (≠ I276), L277 (≠ F279), Q335 (= Q341), I336 (= I342), G338 (= G344), G339 (= G345), I357 (= I363), I360 (= I366), Y361 (= Y367), T364 (= T370), E366 (= E372)
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
51% identity, 96% coverage: 9:379/386 of query aligns to 6:363/371 of 2vigB
- active site: L121 (= L125), S122 (≠ T126), G231 (= G243), E352 (= E368)
- binding coenzyme a persulfide: S128 (= S132), F221 (= F233), M225 (= M237), Q226 (≠ G238), L228 (= L240), D229 (= D241), R232 (= R244), E352 (= E368), G353 (= G369), I357 (= I373)
- binding flavin-adenine dinucleotide: L121 (= L125), S122 (≠ T126), G127 (= G131), S128 (= S132), W152 (= W157), T154 (= T159), R257 (= R269), F260 (= F272), L264 (≠ I276), L267 (≠ F279), Q325 (= Q341), I326 (= I342), G329 (= G345), I347 (= I363), Y351 (= Y367), T354 (= T370), E356 (= E372)
Sites not aligning to the query:
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
47% identity, 98% coverage: 1:380/386 of query aligns to 2:376/378 of 4n5fA
- active site: L126 (= L125), T127 (= T126), G243 (= G243), E364 (= E368), R376 (= R380)
- binding dihydroflavine-adenine dinucleotide: L126 (= L125), T127 (= T126), G132 (= G131), S133 (= S132), F157 (≠ W157), T159 (= T159), T210 (= T210), Y363 (= Y367), T366 (= T370), E368 (= E372), M372 (≠ L376)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
45% identity, 98% coverage: 1:379/386 of query aligns to 1:373/378 of 5ol2F
- active site: L124 (= L125), T125 (= T126), G241 (= G243)
- binding calcium ion: E29 (= E30), E33 (≠ K34), R35 (≠ E36)
- binding coenzyme a persulfide: L238 (= L240), R242 (= R244), E362 (= E368), G363 (= G369)
- binding flavin-adenine dinucleotide: F122 (≠ Y123), L124 (= L125), T125 (= T126), P127 (= P128), T131 (≠ S132), F155 (≠ W157), I156 (= I158), T157 (= T159), E198 (= E200), R267 (= R269), F270 (= F272), L274 (≠ I276), F277 (= F279), Q335 (= Q341), L336 (≠ I342), G338 (= G344), G339 (= G345), Y361 (= Y367), T364 (= T370), E366 (= E372)
Sites not aligning to the query:
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
47% identity, 97% coverage: 6:380/386 of query aligns to 3:370/374 of 5lnxD
- active site: L122 (= L125), T123 (= T126), G239 (= G243), E358 (= E368), K370 (≠ R380)
- binding flavin-adenine dinucleotide: L122 (= L125), T123 (= T126), G128 (= G131), S129 (= S132), F153 (≠ W157), T155 (= T159), R265 (= R269), Q267 (≠ A271), F268 (= F272), I272 (= I276), N275 (≠ F279), I278 (≠ T282), Q331 (= Q341), I332 (= I342), G335 (= G345), Y357 (= Y367), T360 (= T370), E362 (= E372)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
45% identity, 99% coverage: 1:381/386 of query aligns to 1:376/380 of 4l1fA
- active site: L125 (= L125), T126 (= T126), G242 (= G243), E363 (= E368), R375 (= R380)
- binding coenzyme a persulfide: T132 (≠ S132), H179 (≠ R180), F232 (= F233), M236 (= M237), E237 (≠ G238), L239 (= L240), D240 (= D241), R243 (= R244), Y362 (= Y367), E363 (= E368), G364 (= G369), R375 (= R380)
- binding flavin-adenine dinucleotide: F123 (≠ Y123), L125 (= L125), T126 (= T126), G131 (= G131), T132 (≠ S132), F156 (≠ W157), I157 (= I158), T158 (= T159), R268 (= R269), Q270 (≠ A271), F271 (= F272), I275 (= I276), F278 (= F279), L281 (≠ T282), Q336 (= Q341), I337 (= I342), G340 (= G345), I358 (= I363), Y362 (= Y367), T365 (= T370), Q367 (≠ E372)
- binding 1,3-propandiol: L5 (≠ F5), Q10 (≠ L10)
4m9aB Crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264
45% identity, 98% coverage: 2:380/386 of query aligns to 1:374/376 of 4m9aB
- active site: L124 (= L125), T125 (= T126), G241 (= G243), E362 (= E368), R374 (= R380)
- binding dihydroflavine-adenine dinucleotide: F122 (≠ Y123), T125 (= T126), G130 (= G131), S131 (= S132), F155 (≠ W157), T157 (= T159), T208 (= T210), Y361 (= Y367), T364 (= T370), E366 (= E372), M370 (≠ L376)
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
44% identity, 98% coverage: 1:377/386 of query aligns to 1:376/383 of 1bucA
- active site: L128 (= L125), T129 (= T126), G246 (= G243), E367 (= E368)
- binding acetoacetyl-coenzyme a: L96 (= L93), F126 (≠ Y123), G134 (= G131), T135 (≠ S132), T162 (= T159), N182 (≠ A179), H183 (≠ R180), F236 (= F233), M240 (= M237), M241 (≠ G238), L243 (= L240), D244 (= D241), T317 (≠ G318), Y366 (= Y367), E367 (= E368), G368 (= G369)
- binding flavin-adenine dinucleotide: F126 (≠ Y123), L128 (= L125), T129 (= T126), G134 (= G131), T135 (≠ S132), F160 (≠ W157), T162 (= T159), Y366 (= Y367), T369 (= T370), E371 (= E372), M375 (≠ L376)
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
44% identity, 98% coverage: 1:377/386 of query aligns to 1:376/383 of Q06319
- E367 (= E368) active site, Proton acceptor; mutation to Q: Loss of activity.
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
43% identity, 98% coverage: 1:380/386 of query aligns to 1:374/379 of 1ukwB
- active site: L124 (= L125), S125 (≠ T126), T241 (≠ G243), E362 (= E368), R374 (= R380)
- binding cobalt (ii) ion: D145 (= D146), H146 (≠ D148)
- binding flavin-adenine dinucleotide: F122 (≠ Y123), L124 (= L125), S125 (≠ T126), G130 (= G131), S131 (= S132), W155 (= W157), S157 (≠ T159), K200 (= K202), L357 (≠ I363), Y361 (= Y367), E362 (= E368), T364 (= T370), E366 (= E372), L370 (= L376)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
43% identity, 98% coverage: 1:380/386 of query aligns to 1:374/379 of 1ukwA
- active site: L124 (= L125), S125 (≠ T126), T241 (≠ G243), E362 (= E368), R374 (= R380)
- binding flavin-adenine dinucleotide: F122 (≠ Y123), L124 (= L125), S125 (≠ T126), G130 (= G131), S131 (= S132), W155 (= W157), S157 (≠ T159), L357 (≠ I363), Y361 (= Y367), E362 (= E368), T364 (= T370), E366 (= E372), L370 (= L376)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
43% identity, 97% coverage: 5:379/386 of query aligns to 3:373/379 of 6fahD
- active site: L124 (= L125), T125 (= T126), G241 (= G243)
- binding flavin-adenine dinucleotide: F122 (≠ Y123), L124 (= L125), T125 (= T126), R152 (≠ K154), F155 (≠ W157), T157 (= T159), E198 (= E200), R267 (= R269), Q269 (≠ A271), F270 (= F272), I274 (= I276), F277 (= F279), Q335 (= Q341), I336 (= I342), G339 (= G345), Y361 (= Y367), T364 (= T370), Q366 (≠ E372)
Sites not aligning to the query:
2dvlA Crystal structure of project tt0160 from thermus thermophilus hb8
44% identity, 97% coverage: 5:380/386 of query aligns to 1:366/370 of 2dvlA
- active site: L121 (= L125), T122 (= T126), G233 (= G243), E354 (= E368), R366 (= R380)
- binding flavin-adenine dinucleotide: L121 (= L125), T122 (= T126), G127 (= G131), S128 (= S132), W152 (= W157), I153 (= I158), T154 (= T159), T356 (= T370), E358 (= E372)
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
41% identity, 97% coverage: 9:381/386 of query aligns to 1:366/369 of 3pfdC
- active site: L116 (= L125), S117 (≠ T126), T233 (≠ G243), E353 (= E368), R365 (= R380)
- binding dihydroflavine-adenine dinucleotide: Y114 (= Y123), L116 (= L125), S117 (≠ T126), G122 (= G131), S123 (= S132), W147 (= W157), I148 (= I158), T149 (= T159), R259 (= R269), F262 (= F272), V266 (≠ I276), N269 (≠ F279), Q326 (= Q341), L327 (≠ I342), G330 (= G345), I348 (= I363), Y352 (= Y367), T355 (= T370), Q357 (≠ E372)
P45954 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial; SBCAD; 2-methyl branched chain acyl-CoA dehydrogenase; 2-MEBCAD; 2-methylbutyryl-coenzyme A dehydrogenase; 2-methylbutyryl-CoA dehydrogenase; EC 1.3.8.5 from Homo sapiens (Human) (see 6 papers)
40% identity, 98% coverage: 4:380/386 of query aligns to 56:426/432 of P45954
- V137 (≠ T85) mutation to L: Decreased acyl-CoA dehydrogenase activity.
- F138 (≠ V86) mutation to L: Increased acyl-CoA dehydrogenase activity. No effect on substrate specificity.
- 174:183 (vs. 123:132, 40% identical) binding in other chain
- S183 (= S132) binding
- WIS 207:209 (≠ WIT 157:159) binding in other chain
- S210 (= S160) mutation to N: Increased acyl-CoA dehydrogenase activity. Changed substrate specificity.
- Y229 (≠ A179) binding
- L255 (≠ I205) to F: in SBCADD; loss of protein expression; loss of 2-methylbutyryl-CoA dehydrogenase activity; dbSNP:rs137852649
- Y283 (≠ F233) binding
- NEGR 291:294 (≠ DAGR 241:244) binding
- I316 (≠ S266) to V: in dbSNP:rs1131430
- R319 (= R269) binding
- Q330 (= Q280) binding
- EWMGG 387:391 (≠ QIHGG 341:345) binding
- A416 (≠ T370) mutation to T: Increased acyl-CoA dehydrogenase activity. No effect on substrate specificity.
- ASN 416:418 (≠ TSE 370:372) binding in other chain
Sites not aligning to the query:
- 1:33 modified: transit peptide, Mitochondrion
- 13 R → K: in dbSNP:rs12263012
Query Sequence
>N515DRAFT_0492 FitnessBrowser__Dyella79:N515DRAFT_0492
MDFSFTEDQLSIQSIARDFAQKRIVPVAAELDAKGEFPLENIREMGQLGLMGIEVPHEYG
GAGMDPIAYVLAMIEIAAADAATSTVMSVNNSLFCNGILKHGNEEQKQKYVRAIAQGEAI
GAYALTEPQSGSDASAMHTRATKNADGDWVINGKKSWITSGPVARYIVLFAISTPGIGAR
GVSAFIIDTQLPGFAAGKTEPKLGIRASATCEIEFSDYVCPKENLLGEEGKGFSIAMGVL
DAGRIGIASQSVGIARAAYEATLQWSRDRKAFGQAIGSFQMTQAKIADMKCKLDAATLLT
LRAAWTKGQAEKNGGRFGTEASVAKLVASEAAMWIAHQAVQIHGGMGYSKEMPLERYFRD
AKITEIYEGTSEIQRLVIARAETGLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory