Comparing N515DRAFT_0494 FitnessBrowser__Dyella79:N515DRAFT_0494 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
61% identity, 96% coverage: 11:355/361 of query aligns to 4:336/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
55% identity, 94% coverage: 15:354/361 of query aligns to 22:348/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
51% identity, 94% coverage: 15:354/361 of query aligns to 6:308/611 of 4cczA
Sites not aligning to the query:
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
37% identity, 91% coverage: 18:344/361 of query aligns to 8:301/841 of 8g3hA
Sites not aligning to the query:
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
28% identity, 92% coverage: 19:349/361 of query aligns to 11:292/559 of 1q8jA
Sites not aligning to the query:
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
28% identity, 92% coverage: 19:349/361 of query aligns to 11:292/560 of 3bofA
5dmmA Crystal structure of the homocysteine methyltransferase mmum from escherichia coli, metallated form (see paper)
24% identity, 89% coverage: 20:340/361 of query aligns to 9:284/288 of 5dmmA
>N515DRAFT_0494 FitnessBrowser__Dyella79:N515DRAFT_0494
MSALPWLHPDRVALLEAALRERILILDGGMGTMLQGHRLEEEGFRGERFVEGRDHAHEAH
HDHPGCDLKGNNDLLTLTQPAIIRGVHEAYLEAGADLVETNTFNSTRISQADYHLEHLAH
ELNLEGARLARAACDAWTAKTPEQPRFVIGVLGPTSRTASLSPDVNDPGFRNVTFEELAA
NYTEAAAGLVDGGADLIMVETIFDTLNAKAALFAISELFRERGARLPVMISGTITDRSGR
TLSGQTAEAFYYSVAHARPLSVGLNCALGAADLRPHVQTLAQVAGCFVSTHPNAGLPNAF
GEYDETPEQMAAVIGGFARDGLLNLVGGCCGTTPAHIKAIAEAVRDCAPRALPSLDDAEA
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory