SitesBLAST
Comparing N515DRAFT_0537 FitnessBrowser__Dyella79:N515DRAFT_0537 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
43% identity, 98% coverage: 6:315/315 of query aligns to 20:333/339 of Q7XSN8
- E219 (= E205) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (= D211) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
5cvcA Structure of maize serine racemase (see paper)
43% identity, 98% coverage: 6:313/315 of query aligns to 4:316/329 of 5cvcA
- active site: K52 (= K54), S77 (= S79), E203 (= E205), A207 (= A209), D209 (= D211), G231 (= G233), V306 (≠ L303), S307 (≠ T304)
- binding magnesium ion: E203 (= E205), A207 (= A209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), S178 (≠ G180), G179 (= G181), G180 (= G182), G181 (= G183), L232 (= L234), E275 (= E277), S307 (≠ T304), G308 (= G305)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
42% identity, 93% coverage: 23:315/315 of query aligns to 23:318/322 of 3l6bA
- active site: K54 (= K54), S77 (= S79), E203 (= E205), A207 (= A209), D209 (= D211), G232 (= G233), T278 (≠ S279), L305 (= L303), S306 (≠ T304)
- binding malonate ion: K54 (= K54), S76 (= S78), S77 (= S79), N79 (= N81), H80 (= H82), R128 (= R130), G232 (= G233)
- binding manganese (ii) ion: E203 (= E205), A207 (= A209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F53 (= F53), K54 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), M182 (≠ L184), V233 (≠ L234), E276 (= E277), T278 (≠ S279), S306 (≠ T304), G307 (= G305)
6zspAAA serine racemase bound to atp and malonate. (see paper)
42% identity, 93% coverage: 23:315/315 of query aligns to 22:315/320 of 6zspAAA
- active site: K53 (= K54), S74 (= S79), E200 (= E205), A204 (= A209), D206 (= D211), G229 (= G233), L302 (= L303), S303 (≠ T304)
- binding adenosine-5'-triphosphate: S28 (= S29), S29 (≠ A30), I30 (≠ R31), K48 (≠ R49), T49 (≠ G50), Q79 (≠ N84), Y111 (≠ A116), E266 (≠ R270), R267 (≠ E271), K269 (= K273), N306 (= N307)
- binding magnesium ion: E200 (= E205), A204 (= A209), D206 (= D211)
- binding malonate ion: K53 (= K54), S73 (= S78), S74 (= S79), N76 (= N81), H77 (= H82), R125 (= R130), G229 (= G233), S232 (≠ T236)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
42% identity, 93% coverage: 23:315/315 of query aligns to 22:322/323 of 7nbfAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (= A209), D213 (= D211), G236 (= G233), L309 (= L303), S310 (≠ T304)
- binding calcium ion: E207 (= E205), A211 (= A209), D213 (= D211)
- binding magnesium ion: N244 (≠ P241)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ S279), S310 (≠ T304), G311 (= G305)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: L22 (≠ V23), T23 (= T24), P24 (= P25), L26 (= L27), T27 (≠ R28), F46 (≠ L47)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
42% identity, 93% coverage: 23:315/315 of query aligns to 22:322/323 of 7nbdAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (= A209), D213 (= D211), G236 (= G233), L309 (= L303), S310 (≠ T304)
- binding calcium ion: E207 (= E205), A211 (= A209), D213 (= D211)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (= W269), L278 (≠ V275), V314 (= V308), L316 (= L310)
- binding magnesium ion: N244 (≠ P241)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), E280 (= E277), T282 (≠ S279), S310 (≠ T304), G311 (= G305)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
42% identity, 93% coverage: 23:315/315 of query aligns to 22:322/323 of 7nbcCCC
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (= A209), D213 (= D211), G236 (= G233), L309 (= L303), S310 (≠ T304)
- binding biphenyl-4-ylacetic acid: T78 (= T76), H79 (= H77), H84 (= H82), V148 (= V146), H149 (= H147), P150 (= P148)
- binding calcium ion: E207 (= E205), A211 (= A209), D213 (= D211)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ S279), S310 (≠ T304), G311 (= G305)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
42% identity, 93% coverage: 23:315/315 of query aligns to 22:322/323 of 7nbcAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (= A209), D213 (= D211), G236 (= G233), L309 (= L303), S310 (≠ T304)
- binding calcium ion: E207 (= E205), A211 (= A209), D213 (= D211)
- binding magnesium ion: N244 (≠ P241)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ S279), S310 (≠ T304), G311 (= G305)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
42% identity, 93% coverage: 23:315/315 of query aligns to 22:322/322 of 7nbgAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (= A209), D213 (= D211), G236 (= G233), L309 (= L303), S310 (≠ T304)
- binding calcium ion: E207 (= E205), A211 (= A209), D213 (= D211)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N83 (= N81), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G233), V237 (≠ L234), T282 (≠ S279), S310 (≠ T304), G311 (= G305)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S79), G85 (= G83), Q86 (≠ N84), I101 (≠ V99), K111 (= K109), I115 (= I113), Y118 (≠ A116)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
42% identity, 92% coverage: 23:312/315 of query aligns to 22:318/320 of 7nbhAAA
- active site: K53 (= K54), S81 (= S79), E207 (= E205), A211 (= A209), D213 (= D211), G236 (= G233), L309 (= L303), S310 (≠ T304)
- binding calcium ion: E207 (= E205), A211 (= A209), D213 (= D211)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S79), G85 (= G83), Q86 (≠ N84), K111 (= K109), I115 (= I113), Y118 (≠ A116), D235 (= D232), P281 (≠ V278), N313 (= N307), V314 (= V308), D315 (= D309)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
42% identity, 91% coverage: 23:309/315 of query aligns to 22:310/310 of 7nbgDDD
- active site: K53 (= K54), S76 (= S79), E202 (= E205), A206 (= A209), D208 (= D211), G231 (= G233), L304 (= L303), S305 (≠ T304)
- binding calcium ion: E202 (= E205), A206 (= A209), D208 (= D211)
- binding magnesium ion: N239 (≠ P241)
- binding ortho-xylene: S76 (= S79), Q81 (≠ N84), I96 (≠ V99), Y113 (≠ A116)
- binding pyridoxal-5'-phosphate: F52 (= F53), K53 (= K54), N78 (= N81), G177 (= G180), G178 (= G181), G179 (= G182), G180 (= G183), M181 (≠ L184), G231 (= G233), V232 (≠ L234), E275 (= E277), T277 (≠ S279), S305 (≠ T304), G306 (= G305)
Sites not aligning to the query:
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
43% identity, 93% coverage: 23:315/315 of query aligns to 25:324/339 of Q9QZX7
- C113 (≠ A108) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
3hmkA Crystal structure of serine racemase (see paper)
42% identity, 92% coverage: 23:313/315 of query aligns to 23:320/321 of 3hmkA
- active site: K54 (= K54), S82 (= S79), E208 (= E205), A212 (= A209), D214 (= D211), G237 (= G233), T283 (≠ S279), L310 (= L303), S311 (≠ T304)
- binding manganese (ii) ion: E208 (= E205), A212 (= A209), D214 (= D211)
- binding pyridoxal-5'-phosphate: F53 (= F53), K54 (= K54), N84 (= N81), G183 (= G180), G184 (= G181), G185 (= G182), G186 (= G183), M187 (≠ L184), G237 (= G233), V238 (≠ L234), T283 (≠ S279), S311 (≠ T304), G312 (= G305)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
40% identity, 98% coverage: 4:311/315 of query aligns to 3:311/319 of A4F2N8
- K53 (= K54) mutation to A: Loss of enzymatic activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
38% identity, 98% coverage: 4:311/315 of query aligns to 3:311/319 of 2zr8A
- active site: K53 (= K54), S78 (= S79), E204 (= E205), G208 (≠ A209), D210 (= D211), G232 (= G233), I303 (≠ L303), S304 (≠ T304)
- binding magnesium ion: E204 (= E205), G208 (≠ A209), D210 (= D211)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F53), K53 (= K54), S77 (= S78), S78 (= S79), N80 (= N81), H81 (= H82), P147 (= P148), G179 (= G180), G180 (= G181), G181 (= G182), G182 (= G183), G232 (= G233), E277 (= E277), T279 (≠ S279), S304 (≠ T304)
- binding serine: S78 (= S79), R129 (= R130), D231 (= D232), G232 (= G233), A233 (≠ L234), Q234 (≠ R235), T235 (= T236)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
38% identity, 98% coverage: 4:311/315 of query aligns to 3:311/319 of 2zpuA
- active site: K53 (= K54), S78 (= S79), E204 (= E205), G208 (≠ A209), D210 (= D211), G232 (= G233), I303 (≠ L303), S304 (≠ T304)
- binding magnesium ion: E204 (= E205), G208 (≠ A209), D210 (= D211)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F53), K53 (= K54), S77 (= S78), S78 (= S79), N80 (= N81), H81 (= H82), P147 (= P148), G179 (= G180), G180 (= G181), G181 (= G182), G182 (= G183), G232 (= G233), E277 (= E277), T279 (≠ S279), S304 (≠ T304)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
38% identity, 98% coverage: 4:311/315 of query aligns to 2:310/318 of 1wtcA
- active site: K52 (= K54), S77 (= S79), E203 (= E205), G207 (≠ A209), D209 (= D211), G231 (= G233), I302 (≠ L303), S303 (≠ T304)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ A22), K47 (≠ R49), M48 (≠ G50), A109 (≠ E111), A110 (= A112), Y114 (≠ A116)
- binding magnesium ion: E203 (= E205), G207 (≠ A209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (= G233), E276 (= E277), T278 (≠ S279), S303 (≠ T304)
1v71A Crystal structure of s.Pombe serine racemase
38% identity, 98% coverage: 4:311/315 of query aligns to 2:310/318 of 1v71A
- active site: K52 (= K54), S77 (= S79), E203 (= E205), G207 (≠ A209), D209 (= D211), G231 (= G233), I302 (≠ L303), S303 (≠ T304)
- binding magnesium ion: E203 (= E205), G207 (≠ A209), D209 (= D211)
- binding pyridoxal-5'-phosphate: F51 (= F53), K52 (= K54), N79 (= N81), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (= G233), E276 (= E277), T278 (≠ S279), S303 (≠ T304), G304 (= G305)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 98% coverage: 4:311/315 of query aligns to 7:315/323 of O59791
- S82 (= S79) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
41% identity, 97% coverage: 5:311/315 of query aligns to 1:307/308 of 1ve5A
- active site: K50 (= K54), S56 (≠ N60), S72 (= S79), E200 (= E205), A204 (= A209), D206 (= D211), G229 (= G233), L299 (= L303), S300 (≠ T304)
- binding calcium ion: E200 (= E205), A204 (= A209), D206 (= D211)
- binding pyridoxal-5'-phosphate: F49 (= F53), K50 (= K54), N74 (= N81), G175 (= G180), G176 (= G181), G177 (= G182), G178 (= G183), E274 (= E277), T276 (≠ S279), S300 (≠ T304), G301 (= G305)
Query Sequence
>N515DRAFT_0537 FitnessBrowser__Dyella79:N515DRAFT_0537
MSGLPDLDQIRDAAARIAPYAAVTPVLRSARLDALAGAQLHFKCENLQRGGAFKFRGACN
AVWSLDDAQAARGVVTHSSGNHGNALAMAAATRGIAAHVVVPEGAVRAKLEAIEQAGAVL
HRCAPTTAAREAMTAELQRQTGAELVHPYADARVMAGQGTLVLELMRQVEGLDALITPVG
GGGLAAGCAIAAHGLKPELAMYGAEPTGADDAARSLAQGARVEPFQADTLCDGLRTLIGA
PNFDALRTHRTQVITVSDEETIAAMKLLWRELKLVVEVSSATVLAAVLKQAEHFAGRRVG
LVLTGGNVDLDALPW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory