SitesBLAST
Comparing N515DRAFT_0565 FitnessBrowser__Dyella79:N515DRAFT_0565 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
55% identity, 96% coverage: 17:518/523 of query aligns to 15:512/514 of P04968
- K62 (= K64) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N91) binding
- GGGGL 188:192 (= GGGGL 194:198) binding
- S315 (= S321) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
54% identity, 96% coverage: 17:518/523 of query aligns to 11:492/494 of 1tdjA
- active site: K58 (= K64), A83 (= A89), E209 (≠ Q219), S213 (= S223), C215 (≠ A225), G237 (= G247), L310 (≠ V320), S311 (= S321)
- binding pyridoxal-5'-phosphate: F57 (= F63), K58 (= K64), N85 (= N91), G184 (= G194), G185 (= G195), G186 (= G196), G187 (= G197), G237 (= G247), E282 (= E292), S311 (= S321), G312 (= G322)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
38% identity, 61% coverage: 14:330/523 of query aligns to 8:318/326 of 2gn2A
- active site: K56 (= K64), A81 (= A89), Q207 (= Q219), V211 (≠ S223), G213 (≠ A225), G235 (= G247), I308 (≠ V320), S309 (= S321)
- binding cytidine-5'-monophosphate: R51 (≠ P59), T52 (≠ V60), G53 (≠ F61), A114 (= A122), D117 (≠ R125), Y118 (≠ L126), N312 (= N324)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
34% identity, 59% coverage: 21:330/523 of query aligns to 25:332/339 of Q7XSN8
- E219 (≠ Q219) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A225) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
36% identity, 60% coverage: 16:329/523 of query aligns to 7:312/319 of A4F2N8
- K53 (= K64) mutation to A: Loss of enzymatic activity.
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 58% coverage: 26:329/523 of query aligns to 19:316/323 of O59791
- S82 (≠ A89) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
33% identity, 58% coverage: 26:329/523 of query aligns to 14:311/318 of 1wtcA
- active site: K52 (= K64), S77 (≠ A89), E203 (≠ Q219), G207 (≠ S223), D209 (≠ A225), G231 (= G247), I302 (≠ V320), S303 (= S321)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ R32), K47 (≠ P59), M48 (≠ V60), A109 (≠ D121), A110 (= A122), Y114 (≠ L126)
- binding magnesium ion: E203 (≠ Q219), G207 (≠ S223), D209 (≠ A225)
- binding pyridoxal-5'-phosphate: F51 (= F63), K52 (= K64), N79 (= N91), G178 (= G194), G179 (= G195), G180 (= G196), G181 (= G197), G231 (= G247), E276 (= E292), T278 (≠ S294), S303 (= S321)
1v71A Crystal structure of s.Pombe serine racemase
33% identity, 58% coverage: 26:329/523 of query aligns to 14:311/318 of 1v71A
- active site: K52 (= K64), S77 (≠ A89), E203 (≠ Q219), G207 (≠ S223), D209 (≠ A225), G231 (= G247), I302 (≠ V320), S303 (= S321)
- binding magnesium ion: E203 (≠ Q219), G207 (≠ S223), D209 (≠ A225)
- binding pyridoxal-5'-phosphate: F51 (= F63), K52 (= K64), N79 (= N91), G178 (= G194), G179 (= G195), G180 (= G196), G181 (= G197), G231 (= G247), E276 (= E292), T278 (≠ S294), S303 (= S321), G304 (= G322)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
33% identity, 58% coverage: 26:329/523 of query aligns to 15:312/319 of 2zr8A
- active site: K53 (= K64), S78 (≠ A89), E204 (≠ Q219), G208 (≠ S223), D210 (≠ A225), G232 (= G247), I303 (≠ V320), S304 (= S321)
- binding magnesium ion: E204 (≠ Q219), G208 (≠ S223), D210 (≠ A225)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F63), K53 (= K64), S77 (= S88), S78 (≠ A89), N80 (= N91), H81 (= H92), P147 (= P161), G179 (= G194), G180 (= G195), G181 (= G196), G182 (= G197), G232 (= G247), E277 (= E292), T279 (≠ S294), S304 (= S321)
- binding serine: S78 (≠ A89), R129 (≠ Q144), D231 (= D246), G232 (= G247), A233 (≠ T248), Q234 (≠ A249), T235 (≠ V250)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
33% identity, 58% coverage: 26:329/523 of query aligns to 15:312/319 of 2zpuA
- active site: K53 (= K64), S78 (≠ A89), E204 (≠ Q219), G208 (≠ S223), D210 (≠ A225), G232 (= G247), I303 (≠ V320), S304 (= S321)
- binding magnesium ion: E204 (≠ Q219), G208 (≠ S223), D210 (≠ A225)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F63), K53 (= K64), S77 (= S88), S78 (≠ A89), N80 (= N91), H81 (= H92), P147 (= P161), G179 (= G194), G180 (= G195), G181 (= G196), G182 (= G197), G232 (= G247), E277 (= E292), T279 (≠ S294), S304 (= S321)
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
42% identity, 52% coverage: 55:328/523 of query aligns to 41:307/308 of 1ve5A
- active site: K50 (= K64), S56 (≠ N70), S72 (≠ A89), E200 (≠ Q219), A204 (≠ S223), D206 (≠ A225), G229 (= G247), L299 (≠ V320), S300 (= S321)
- binding calcium ion: E200 (≠ Q219), A204 (≠ S223), D206 (≠ A225)
- binding pyridoxal-5'-phosphate: F49 (= F63), K50 (= K64), N74 (= N91), G175 (= G194), G176 (= G195), G177 (= G196), G178 (= G197), E274 (= E292), T276 (≠ S294), S300 (= S321), G301 (= G322)
5cvcA Structure of maize serine racemase (see paper)
33% identity, 61% coverage: 14:330/523 of query aligns to 3:316/329 of 5cvcA
- active site: K52 (= K64), S77 (≠ A89), E203 (≠ Q219), A207 (≠ S223), D209 (≠ A225), G231 (= G247), V306 (= V320), S307 (= S321)
- binding magnesium ion: E203 (≠ Q219), A207 (≠ S223), D209 (≠ A225)
- binding pyridoxal-5'-phosphate: F51 (= F63), K52 (= K64), N79 (= N91), S178 (≠ G194), G179 (= G195), G180 (= G196), G181 (= G197), L232 (≠ T248), E275 (= E292), S307 (= S321), G308 (= G322)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
33% identity, 56% coverage: 34:327/523 of query aligns to 23:316/320 of 7nbhAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225), G236 (= G247), L309 (≠ V320), S310 (= S321)
- binding calcium ion: E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A89), G85 (≠ A93), Q86 (= Q94), K111 (= K119), I115 (≠ V123), Y118 (≠ L126), D235 (= D246), P281 (= P293), N313 (= N324), V314 (≠ L325), D315 (≠ N326)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
33% identity, 56% coverage: 34:327/523 of query aligns to 23:316/323 of 7nbfAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225), G236 (= G247), L309 (≠ V320), S310 (= S321)
- binding calcium ion: E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225)
- binding magnesium ion: N244 (≠ E256)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G194), G183 (= G195), G184 (= G196), G185 (= G197), M186 (≠ L198), G236 (= G247), V237 (≠ T248), T282 (≠ S294), S310 (= S321), G311 (= G322)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: T23 (= T34), P24 (≠ A35), L26 (≠ E37), T27 (≠ S38), F46 (≠ Q57)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
33% identity, 56% coverage: 34:327/523 of query aligns to 23:316/323 of 7nbdAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225), G236 (= G247), L309 (≠ V320), S310 (= S321)
- binding calcium ion: E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F284), L278 (≠ V290), V314 (≠ L325), L316 (≠ F327)
- binding magnesium ion: N244 (≠ E256)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G194), G183 (= G195), G184 (= G196), G185 (= G197), M186 (≠ L198), G236 (= G247), V237 (≠ T248), E280 (= E292), T282 (≠ S294), S310 (= S321), G311 (= G322)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 56% coverage: 34:327/523 of query aligns to 23:316/323 of 7nbcCCC
- active site: K53 (= K64), S81 (≠ A89), E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225), G236 (= G247), L309 (≠ V320), S310 (= S321)
- binding biphenyl-4-ylacetic acid: T78 (≠ A86), H79 (≠ A87), H84 (= H92), V148 (= V159), H149 (= H160), P150 (= P161)
- binding calcium ion: E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G194), G183 (= G195), G184 (= G196), G185 (= G197), M186 (≠ L198), G236 (= G247), V237 (≠ T248), T282 (≠ S294), S310 (= S321), G311 (= G322)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 56% coverage: 34:327/523 of query aligns to 23:316/323 of 7nbcAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225), G236 (= G247), L309 (≠ V320), S310 (= S321)
- binding calcium ion: E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225)
- binding magnesium ion: N244 (≠ E256)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G194), G183 (= G195), G184 (= G196), G185 (= G197), M186 (≠ L198), G236 (= G247), V237 (≠ T248), T282 (≠ S294), S310 (= S321), G311 (= G322)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 56% coverage: 34:327/523 of query aligns to 23:316/322 of 7nbgAAA
- active site: K53 (= K64), S81 (≠ A89), E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225), G236 (= G247), L309 (≠ V320), S310 (= S321)
- binding calcium ion: E207 (≠ Q219), A211 (≠ S223), D213 (≠ A225)
- binding pyridoxal-5'-phosphate: F52 (= F63), K53 (= K64), N83 (= N91), G182 (= G194), G183 (= G195), G184 (= G196), G185 (= G197), M186 (≠ L198), G236 (= G247), V237 (≠ T248), T282 (≠ S294), S310 (= S321), G311 (= G322)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A89), G85 (≠ A93), Q86 (= Q94), I101 (= I109), K111 (= K119), I115 (≠ V123), Y118 (≠ L126)
6zspAAA serine racemase bound to atp and malonate. (see paper)
32% identity, 58% coverage: 34:338/523 of query aligns to 23:320/320 of 6zspAAA
- active site: K53 (= K64), S74 (≠ A89), E200 (≠ Q219), A204 (≠ S223), D206 (≠ A225), G229 (= G247), L302 (≠ V320), S303 (= S321)
- binding adenosine-5'-triphosphate: S28 (≠ A39), S29 (≠ P40), I30 (≠ L41), K48 (≠ P59), T49 (≠ V60), Q79 (= Q94), Y111 (≠ L126), E266 (≠ Q285), R267 (≠ E286), K269 (≠ R288), N306 (= N324)
- binding magnesium ion: E200 (≠ Q219), A204 (≠ S223), D206 (≠ A225)
- binding malonate ion: K53 (= K64), S73 (= S88), S74 (≠ A89), N76 (= N91), H77 (= H92), R125 (≠ A143), G229 (= G247), S232 (≠ K251)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
33% identity, 56% coverage: 34:327/523 of query aligns to 24:312/322 of 3l6bA
- active site: K54 (= K64), S77 (≠ A89), E203 (≠ Q219), A207 (≠ S223), D209 (≠ A225), G232 (= G247), T278 (≠ S294), L305 (≠ V320), S306 (= S321)
- binding malonate ion: K54 (= K64), S76 (= S88), S77 (≠ A89), N79 (= N91), H80 (= H92), R128 (≠ A143), G232 (= G247)
- binding manganese (ii) ion: E203 (≠ Q219), A207 (≠ S223), D209 (≠ A225)
- binding pyridoxal-5'-phosphate: F53 (= F63), K54 (= K64), N79 (= N91), G178 (= G194), G179 (= G195), G180 (= G196), G181 (= G197), M182 (≠ L198), V233 (≠ T248), E276 (= E292), T278 (≠ S294), S306 (= S321), G307 (= G322)
Query Sequence
>N515DRAFT_0565 FitnessBrowser__Dyella79:N515DRAFT_0565
MNAVAAHRPPTEEADHDLLRRTLAARVYEVARETALESAPLLSARLGQRVLLKREDQQPV
FSFKLRGAYNKMVGLDAAQRARGVIAASAGNHAQGVALAAAKLGLRAVIVMPVTAPQVKI
DAVRRLGGAWVEVVLAGDSYSDAQAEAARLEQQHGYTFVHPFDDPAVIAGQATVGMEILR
QHPGPLHAVFVPVGGGGLLAGVAAYIKALRPEVKVIGVQTVDSDAMAQSLEQGERVTLDE
VGLFADGTAVKRVGAETFALCQRHVDAMLRVDTDAICAAIRDVFQETRSVPEPSGALALA
GLKQYAATHQLDDATLVAIVSGANLNFDRLRFVAERAEVGEQREAVFAVTIPEERGSFRR
FCATLGQRSITEFNYRIGDAASAHIFVGIQIRQRDEREALTAAFAAEGFGVLDLTDDELA
KLHLRHMIGGRSPLAHDELLYRFEFPERPGALTRFLGHMHPDWNISLFHYRNHGADYGRI
LVGIQVPAGERAMFEQFLAQLGYPCRDESGNPAYRLLLREASP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory