SitesBLAST
Comparing N515DRAFT_0567 FitnessBrowser__Dyella79:N515DRAFT_0567 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
44% identity, 93% coverage: 27:605/625 of query aligns to 95:659/667 of P09342
- C161 (≠ A103) modified: Disulfide link with 307
- P194 (= P136) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A255) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
44% identity, 93% coverage: 27:605/625 of query aligns to 92:656/664 of P09114
- P191 (= P136) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W522) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 12:576/582 of 3ea4A
- active site: Y32 (= Y47), G34 (= G49), G35 (= G50), A36 (= A51), S37 (≠ I52), E58 (= E83), T81 (= T106), F120 (= F145), Q121 (= Q146), E122 (= E147), K170 (= K195), M265 (= M296), V292 (= V323), V399 (= V433), G425 (= G459), M427 (= M461), D452 (= D486), N479 (= N513), H481 (≠ G515), L482 (≠ D516), M484 (= M518), V485 (= V519), W488 (= W522), H557 (≠ P586)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D321), R291 (= R322), W488 (= W522), S567 (≠ P596)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R185), G221 (= G250), G222 (= G251), G223 (= G252), T245 (= T276), L246 (= L277), M247 (= M278), L263 (= L294), G264 (= G295), M265 (= M296), H266 (= H297), G285 (= G316), R287 (= R318), D289 (= D320), R291 (= R322), D309 (= D341), I310 (= I342), G327 (= G359), D328 (= D360), V329 (≠ L361), M404 (= M438), G422 (= G456)
- binding magnesium ion: D452 (= D486), N479 (= N513), H481 (≠ G515)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V433), G400 (= G434), Q401 (= Q435), H402 (= H436), M427 (= M461), G451 (= G485), D452 (= D486), G453 (≠ A487), S454 (= S488), N479 (= N513), H481 (≠ G515), L482 (≠ D516), G483 (= G517), M484 (= M518), V485 (= V519)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 12:576/582 of 3e9yA
- active site: Y32 (= Y47), G34 (= G49), G35 (= G50), A36 (= A51), S37 (≠ I52), E58 (= E83), T81 (= T106), F120 (= F145), Q121 (= Q146), E122 (= E147), K170 (= K195), M265 (= M296), V292 (= V323), V399 (= V433), G425 (= G459), M427 (= M461), D452 (= D486), N479 (= N513), H481 (≠ G515), L482 (≠ D516), M484 (= M518), V485 (= V519), W488 (= W522), H557 (≠ P586)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D321), R291 (= R322), W488 (= W522), S567 (≠ P596)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R185), G221 (= G250), G222 (= G251), G223 (= G252), T245 (= T276), L246 (= L277), M247 (= M278), L263 (= L294), G285 (= G316), R287 (= R318), D289 (= D320), R291 (= R322), D309 (= D341), I310 (= I342), G327 (= G359), D328 (= D360), V329 (≠ L361), M404 (= M438), G422 (= G456)
- binding magnesium ion: D452 (= D486), N479 (= N513), H481 (≠ G515)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V433), G400 (= G434), Q401 (= Q435), H402 (= H436), M427 (= M461), G451 (= G485), G453 (≠ A487), S454 (= S488), N479 (= N513), H481 (≠ G515), L482 (≠ D516), G483 (= G517), M484 (= M518), V485 (= V519)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), G426 (= G459), M428 (= M461), G452 (= G485), D453 (= D486), G454 (≠ A487), S455 (= S488), M458 (= M491), N480 (= N513), H482 (≠ G515), L483 (≠ D516), G484 (= G517), M485 (= M518), V486 (= V519)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), M266 (= M296), H267 (= H297), G286 (= G316), V287 (≠ A317), R288 (= R318), D290 (= D320), R292 (= R322), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456)
- binding magnesium ion: F370 (≠ Y403), D453 (= D486), M458 (= M491), Q461 (≠ G494), N480 (= N513), H482 (≠ G515), K533 (≠ R561)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M296), R292 (= R322), M485 (= M518), W489 (= W522), S568 (≠ P596)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 5wj1A
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), M263 (= M293), L264 (= L294), G286 (= G316), R288 (= R318), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456), G424 (≠ S457)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M296), D291 (= D321), R292 (= R322), M485 (= M518), W489 (= W522), S568 (≠ P596)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), M428 (= M461), D453 (= D486), G454 (≠ A487), S455 (= S488), M458 (= M491), N480 (= N513), H482 (≠ G515), L483 (≠ D516), G484 (= G517), M485 (= M518), V486 (= V519)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 5k6tA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H297), R292 (= R322), M485 (= M518), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), G286 (= G316), R288 (= R318), D290 (= D320), R292 (= R322), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), Q404 (= Q437), M405 (= M438), G423 (= G456)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), G426 (= G459), M428 (= M461), G452 (= G485), G454 (≠ A487), S455 (= S488), N480 (= N513), H482 (≠ G515), L483 (≠ D516), G484 (= G517)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 5k6rA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R322), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), M266 (= M296), G286 (= G316), R288 (= R318), R292 (= R322), V293 (= V323), D310 (= D341), I311 (= I342), G328 (= G359), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), G426 (= G459), M428 (= M461), D453 (= D486), G454 (≠ A487), S455 (= S488), M458 (= M491), N480 (= N513), H482 (≠ G515), L483 (≠ D516), G484 (= G517), M485 (= M518), V486 (= V519)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 1z8nA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K159), R161 (= R185), Y191 (= Y215), R194 (= R218), D291 (= D321), R292 (= R322), D312 (= D343), W489 (= W522), G569 (= G597)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), G265 (= G295), M266 (= M296), H267 (= H297), G286 (= G316), V287 (≠ A317), R288 (= R318), D290 (= D320), R292 (= R322), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456), G424 (≠ S457)
- binding magnesium ion: D453 (= D486), N480 (= N513)
- binding thiamine diphosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), G426 (= G459), M428 (= M461), G452 (= G485), G454 (≠ A487), S455 (= S488), N480 (= N513), H482 (≠ G515), L483 (≠ D516), G484 (= G517), M485 (= M518), V486 (= V519)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 1yi1A
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D321), R292 (= R322), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), M263 (= M293), L264 (= L294), G265 (= G295), M266 (= M296), H267 (= H297), G286 (= G316), V287 (≠ A317), R288 (= R318), D290 (= D320), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456), G424 (≠ S457)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 1yi0A
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D321), R292 (= R322), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), G265 (= G295), M266 (= M296), H267 (= H297), G286 (= G316), V287 (≠ A317), R288 (= R318), D290 (= D320), R292 (= R322), V293 (= V323), D310 (= D341), I311 (= I342), G328 (= G359), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456), G424 (≠ S457)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 1yhzA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D321), R292 (= R322), M485 (= M518), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), M266 (= M296), H267 (= H297), G286 (= G316), V287 (≠ A317), R288 (= R318), D290 (= D320), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), Q404 (= Q437), M405 (= M438), G423 (= G456), G424 (≠ S457)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 1yhyA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D321), R292 (= R322), V486 (= V519), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), G265 (= G295), M266 (= M296), H267 (= H297), G286 (= G316), V287 (≠ A317), R288 (= R318), D290 (= D320), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), Q404 (= Q437), M405 (= M438), G423 (= G456), G424 (≠ S457)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 1ybhA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M296), D291 (= D321), R292 (= R322), M485 (= M518), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), M266 (= M296), H267 (= H297), G286 (= G316), V287 (≠ A317), R288 (= R318), D290 (= D320), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), Q404 (= Q437), M405 (= M438), G423 (= G456), G424 (≠ S457)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
43% identity, 93% coverage: 27:605/625 of query aligns to 98:662/670 of P17597
- A122 (= A51) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L53) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E83) binding
- S186 (= S125) binding
- P197 (= P136) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ T138) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q146) binding
- K220 (= K159) binding
- R246 (= R185) binding ; binding
- K256 (= K195) binding
- G308 (= G251) binding
- TL 331:332 (= TL 276:277) binding
- C340 (≠ T285) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 294:297) binding
- GVRFD 371:375 (≠ GARFD 316:320) binding
- DR 376:377 (= DR 321:322) binding
- DI 395:396 (= DI 341:342) binding
- DV 414:415 (≠ DL 360:361) binding
- QH 487:488 (= QH 435:436) binding
- GG 508:509 (≠ GS 456:457) binding
- GAM 511:513 (≠ GTM 459:461) binding
- D538 (= D486) binding
- DGS 538:540 (≠ DAS 486:488) binding
- N565 (= N513) binding
- NQHLGM 565:570 (≠ NIGDGM 513:518) binding
- H567 (≠ G515) binding
- W574 (= W522) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P596) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/583 of 5k3sA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R322), M485 (= M518), W489 (= W522), G569 (= G597)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), M266 (= M296), G286 (= G316), R288 (= R318), D290 (= D320), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), G426 (= G459), M428 (= M461), D453 (= D486), G454 (≠ A487), S455 (= S488), N480 (= N513), H482 (≠ G515), L483 (≠ D516), G484 (= G517), M485 (= M518), V486 (= V519)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/585 of 5k2oA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), S38 (≠ I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), M266 (= M296), V293 (= V323), V400 (= V433), G426 (= G459), M428 (= M461), D453 (= D486), N480 (= N513), H482 (≠ G515), L483 (≠ D516), M485 (= M518), V486 (= V519), W489 (= W522), H558 (≠ P586)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M296), R292 (= R322), W489 (= W522), S568 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), L264 (= L294), G286 (= G316), R288 (= R318), D290 (= D320), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), Q404 (= Q437), M405 (= M438), G423 (= G456)
- binding magnesium ion: D453 (= D486), N480 (= N513), H482 (≠ G515)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), M428 (= M461), D453 (= D486), G454 (≠ A487), S455 (= S488), N480 (= N513), H482 (≠ G515), L483 (≠ D516), G484 (= G517), M485 (= M518), V486 (= V519)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
42% identity, 94% coverage: 26:613/625 of query aligns to 12:584/597 of 6demA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), I38 (= I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), K228 (≠ E261), M264 (= M296), V291 (= V323), V407 (= V433), L432 (≠ M458), G433 (= G459), M435 (= M461), D460 (= D486), N487 (= N513), E489 (≠ G515), Q490 (≠ D516), M492 (= M518), V493 (= V519), W496 (= W522), L518 (≠ A546), N523 (≠ G551), V524 (≠ F552)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M296), D289 (= D321), R290 (= R322), M492 (= M518), W496 (= W522), A567 (≠ P596)
- binding flavin-adenine dinucleotide: R161 (= R185), G217 (= G250), A218 (≠ G251), G219 (= G252), N222 (≠ A255), T244 (= T276), L245 (= L277), Q246 (≠ M278), L262 (= L294), G284 (= G316), A285 (= A317), R286 (= R318), D288 (= D320), R290 (= R322), V291 (= V323), E317 (≠ D341), I318 (= I342), N322 (≠ E346), D336 (= D360), V337 (≠ L361), M412 (= M438), G430 (= G456)
- binding magnesium ion: D460 (= D486), N487 (= N513), E489 (≠ G515)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V433), G408 (= G434), Q409 (= Q435), H410 (= H436), M435 (= M461), G459 (= G485), D460 (= D486), A461 (= A487), S462 (= S488), M465 (= M491), N487 (= N513), E489 (≠ G515), Q490 (≠ D516), G491 (= G517), M492 (= M518), V493 (= V519)
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
42% identity, 94% coverage: 26:613/625 of query aligns to 12:584/597 of 6delA
- active site: Y33 (= Y47), G35 (= G49), G36 (= G50), A37 (= A51), I38 (= I52), E59 (= E83), T82 (= T106), F121 (= F145), Q122 (= Q146), E123 (= E147), K171 (= K195), K228 (≠ E261), M264 (= M296), V291 (= V323), V407 (= V433), L432 (≠ M458), G433 (= G459), M435 (= M461), D460 (= D486), N487 (= N513), E489 (≠ G515), Q490 (≠ D516), M492 (= M518), V493 (= V519), W496 (= W522), L518 (≠ A546), N523 (≠ G551), V524 (≠ F552)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D321), R290 (= R322), W496 (= W522)
- binding flavin-adenine dinucleotide: R161 (= R185), G217 (= G250), A218 (≠ G251), G219 (= G252), N222 (≠ A255), T244 (= T276), L245 (= L277), Q246 (≠ M278), L262 (= L294), G284 (= G316), A285 (= A317), R286 (= R318), D288 (= D320), R290 (= R322), V291 (= V323), E317 (≠ D341), I318 (= I342), N322 (≠ E346), D336 (= D360), V337 (≠ L361), M412 (= M438), G430 (= G456)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V433), G408 (= G434), Q409 (= Q435), H410 (= H436), G433 (= G459), M435 (= M461), G459 (= G485), D460 (= D486), A461 (= A487), S462 (= S488), M465 (= M491), N487 (= N513), E489 (≠ G515), Q490 (≠ D516), G491 (= G517), M492 (= M518), V493 (= V519)
- binding magnesium ion: D460 (= D486), N487 (= N513), E489 (≠ G515)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V433), G408 (= G434), Q409 (= Q435), H410 (= H436), G433 (= G459), M435 (= M461), G459 (= G485), D460 (= D486), A461 (= A487), S462 (= S488), M465 (= M491), N487 (= N513), E489 (≠ G515), Q490 (≠ D516), G491 (= G517), M492 (= M518), V493 (= V519)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
43% identity, 93% coverage: 27:605/625 of query aligns to 13:577/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M296), R292 (= R322), W489 (= W522), S568 (≠ P596)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V433), G401 (= G434), Q402 (= Q435), H403 (= H436), G426 (= G459), M428 (= M461), G452 (= G485), D453 (= D486), G454 (≠ A487), S455 (= S488), L483 (≠ D516), G484 (= G517), M485 (= M518), V486 (= V519)
- binding flavin-adenine dinucleotide: R161 (= R185), G222 (= G250), G223 (= G251), G224 (= G252), T246 (= T276), L247 (= L277), M248 (= M278), M263 (= M293), L264 (= L294), M266 (= M296), H267 (= H297), G286 (= G316), R288 (= R318), V293 (= V323), D310 (= D341), I311 (= I342), D329 (= D360), V330 (≠ L361), M405 (= M438), G423 (= G456)
- binding magnesium ion: A37 (= A51), T82 (= T106), S83 (= S107), Q122 (= Q146), Y381 (≠ A414), D453 (= D486), M458 (= M491), Q461 (≠ G494), N480 (= N513), H482 (≠ G515), K533 (≠ R561)
Query Sequence
>N515DRAFT_0567 FitnessBrowser__Dyella79:N515DRAFT_0567
MNALLPHTYDAVPEDDATHPLNALRMSGAEVVVQVLADEGVDVLFGYSGGAILPVYDAVF
RYNATHIGPSGGEPMPLIVPANEQGAGFMAAGYARASGKVGVAIVTSGPGATNMVTPVRD
SMSDSVPMVVLCGQVPTTAIGSDAFQEAPIANIMSACAKHVFLVTDAEKLEATLRTAFEI
ARSGRPGPVVVDIPKDVQNTLLPFHGEGLLPMPGYRARLQRLEQSTLDDAQCVAFFEALA
QSKRPLIYAGGGTIASGASHELRAFVADYGLPVTTTLMGLGAYDTTEPLALHMLGMHGTA
YANYAVEDCDFLFTLGARFDDRVAGVPDKFAPQAKFIAQIDIDPAEIGKVKSVDWHHTGD
LTRTLAQLRAWGERHGWREQLSARYAPWHRHVAELKQVHALDYDRASPLIQPYAVIEEIN
RHTQGHAVISTGVGQHQMWAAQYFDFREPRHWLSSGSMGTMGFGLPAAIGAQFARPGAVV
IDIDGDASIRMNLGELETVTTYGLPVKVVVLNNIGDGMVRQWQKLFFRGRFASSDKSLHR
KDFIKAAQADGFEWARRLERREELAATIADFLAHPGPAFLEVMIDPDAGVYPMVGPGATY
AQMITGDHIASRQAVQADGAASDMF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory