SitesBLAST
Comparing N515DRAFT_0568 FitnessBrowser__Dyella79:N515DRAFT_0568 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
C8WR67 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) (Bacillus acidocaldarius) (see paper)
61% identity, 93% coverage: 10:325/339 of query aligns to 15:329/344 of C8WR67
- YGSQ 25:28 (= YGSQ 20:23) binding
- R48 (= R43) binding ; mutation to P: Inversion of the cofactor specificity from NADPH to NADH.
- S52 (= S48) binding ; mutation to D: Inversion of the cofactor specificity from NADPH to NADH.
- DERQ 82:85 (≠ DMVQ 78:81) binding
- G133 (= G129) binding
- D190 (= D186) binding
- E194 (= E190) binding
- E226 (= E222) binding
4tskA Ketol-acid reductoisomerase from alicyclobacillus acidocaldarius (see paper)
61% identity, 93% coverage: 10:325/339 of query aligns to 14:328/333 of 4tskA
- active site: K129 (= K126), D189 (= D186), E193 (= E190)
- binding magnesium ion: D189 (= D186), D189 (= D186), E193 (= E190), E193 (= E190), R246 (≠ L243), Y247 (≠ E244), I249 (≠ V246), D251 (≠ E248), Q254 (= Q251)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y20), G25 (= G21), S26 (= S22), Q27 (= Q23), L46 (= L42), R47 (= R43), S51 (= S48), L78 (= L75), L79 (≠ T76), P80 (= P77), D81 (= D78), H106 (= H103), P131 (= P128)
C1DFH7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Azotobacter vinelandii (strain DJ / ATCC BAA-1303) (see paper)
54% identity, 93% coverage: 10:325/339 of query aligns to 14:329/338 of C1DFH7
- D190 (= D186) binding
- E226 (= E222) binding
- E230 (= E226) binding
4xiyA Crystal structure of ketol-acid reductoisomerase from azotobacter (see paper)
54% identity, 93% coverage: 10:323/339 of query aligns to 14:327/328 of 4xiyA
P9WKJ7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
56% identity, 91% coverage: 14:323/339 of query aligns to 20:329/337 of P9WKJ7
- D192 (= D186) binding ; binding
- E196 (= E190) binding
- E228 (= E222) binding
- E232 (= E226) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4ypoA Crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+ (see paper)
56% identity, 91% coverage: 14:323/339 of query aligns to 16:325/325 of 4ypoA
6jx2B Crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum (see paper)
57% identity, 91% coverage: 14:323/339 of query aligns to 18:327/327 of 6jx2B
8ep7C Crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with NADP
57% identity, 93% coverage: 10:325/339 of query aligns to 14:328/328 of 8ep7C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y20), G25 (= G21), S26 (= S22), Q27 (= Q23), R47 (= R43), S51 (= S48), L78 (= L75), L79 (≠ T76), P80 (= P77), D81 (= D78), Q83 (≠ V80), V87 (≠ L84), H106 (= H103)
6jx2A Crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum (see paper)
57% identity, 91% coverage: 14:321/339 of query aligns to 18:325/325 of 6jx2A
- binding magnesium ion: N98 (≠ K94), D101 (≠ A97), D190 (= D186), E194 (= E190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G19), Y24 (= Y20), G25 (= G21), R47 (= R43), S50 (≠ G46), K51 (≠ P47), S52 (= S48), A80 (≠ T76), P81 (= P77), I88 (≠ L84)
7rduA Crystal structure of campylobacter jejuni keto said reductoisomerase in complex with magnesium and oxidixized and reduced NADPH
51% identity, 93% coverage: 10:324/339 of query aligns to 15:329/329 of 7rduA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G19), G26 (= G21), S27 (= S22), Q28 (= Q23), R48 (= R43), S51 (≠ G46), S53 (= S48), A81 (≠ T76), P82 (= P77), D83 (= D78), I89 (≠ L84), A107 (= A102), H108 (= H103), P130 (= P125), K131 (= K126), A132 (≠ G127)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G24 (= G19), F25 (≠ Y20), G26 (= G21), S27 (= S22), Q28 (= Q23), S51 (≠ G46), S53 (= S48), L80 (= L75), P82 (= P77), D83 (= D78), I89 (≠ L84), A107 (= A102), H108 (= H103)
7latA Campylobacter jejuni keto-acid reductoisomerase in complex with mg2+
51% identity, 93% coverage: 10:324/339 of query aligns to 15:329/329 of 7latA
6bulB Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
56% identity, 93% coverage: 10:324/339 of query aligns to 14:327/327 of 6bulB
- active site: K129 (= K126), D189 (= D186), E193 (= E190)
- binding {hydroxy[(1S)-1-phenylethyl]amino}(oxo)acetic acid: P131 (= P128), D189 (= D186), E193 (= E190), E229 (= E226), I233 (= I230), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding oxo{[(1S)-1-phenylethyl]amino}acetic acid: P131 (= P128), D189 (= D186), E193 (= E190), E229 (= E226), I233 (= I230), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding magnesium ion: D189 (= D186), E193 (= E190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y20), G25 (= G21), S26 (= S22), Q27 (= Q23), I46 (≠ L42), R47 (= R43), S51 (= S48), L78 (= L75), L79 (≠ T76), P80 (= P77), D81 (= D78), H106 (= H103), P131 (= P128), S248 (≠ F245), I249 (≠ V246), S250 (= S247)
6vo2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, NADPH and inhibitor. (see paper)
56% identity, 93% coverage: 10:323/339 of query aligns to 14:326/326 of 6vo2A
- binding magnesium ion: D189 (= D186), E193 (= E190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y20), G25 (= G21), S26 (= S22), Q27 (= Q23), I46 (≠ L42), R47 (= R43), S51 (= S48), L78 (= L75), L79 (≠ T76), P80 (= P77), D81 (= D78), H106 (= H103), P131 (= P128), I249 (≠ V246), S250 (= S247)
- binding 3-(methylsulfonyl)-2-oxopropanoic acid: G130 (= G127), P131 (= P128), D189 (= D186), E193 (= E190), E229 (= E226), I249 (≠ V246), S250 (= S247), A253 (= A250)
6c5nA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
56% identity, 93% coverage: 10:323/339 of query aligns to 14:326/326 of 6c5nA
- active site: K129 (= K126), D189 (= D186), E193 (= E190)
- binding (cyclopentylamino)(oxo)acetic acid: P131 (= P128), D189 (= D186), E193 (= E190), C198 (= C195), E229 (= E226), I233 (= I230), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding [cyclopentyl(hydroxy)amino](oxo)acetic acid: P131 (= P128), D189 (= D186), E193 (= E190), C198 (= C195), E229 (= E226), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding magnesium ion: D189 (= D186), E193 (= E190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y20), G25 (= G21), S26 (= S22), Q27 (= Q23), I46 (≠ L42), R47 (= R43), S51 (= S48), L78 (= L75), L79 (≠ T76), P80 (= P77), D81 (= D78), H106 (= H103), P131 (= P128), S248 (≠ F245), I249 (≠ V246), S250 (= S247)
6c55A Crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3
56% identity, 93% coverage: 10:323/339 of query aligns to 14:326/326 of 6c55A
- active site: K129 (= K126), D189 (= D186), E193 (= E190)
- binding [cyclohexyl(hydroxy)amino](oxo)acetic acid: P131 (= P128), D189 (= D186), E193 (= E190), C198 (= C195)
- binding (cyclohexylamino)(oxo)acetic acid: P131 (= P128), D189 (= D186), E193 (= E190), C198 (= C195), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding magnesium ion: D189 (= D186), E193 (= E190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G21), S26 (= S22), Q27 (= Q23), I46 (≠ L42), R47 (= R43), S51 (= S48), L79 (≠ T76), P80 (= P77), D81 (= D78), I83 (≠ V80), H106 (= H103), S248 (≠ F245), S250 (= S247)
6aqjA Crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. (see paper)
56% identity, 93% coverage: 10:323/339 of query aligns to 14:326/326 of 6aqjA
- active site: K129 (= K126), D189 (= D186), E193 (= E190)
- binding oxo(propan-2-ylamino)acetic acid: P131 (= P128), D189 (= D186), E193 (= E190), E229 (= E226), I233 (= I230), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding n-hydroxy-n-isopropyloxamic acid: P131 (= P128), D189 (= D186), E193 (= E190), E229 (= E226), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding magnesium ion: D189 (= D186), E193 (= E190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y20), G25 (= G21), S26 (= S22), Q27 (= Q23), I46 (≠ L42), R47 (= R43), S51 (= S48), L78 (= L75), L79 (≠ T76), P80 (= P77), D81 (= D78), H106 (= H103), P131 (= P128), I249 (≠ V246), S250 (= S247)
5w3kA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex NADPH, mg2+ and cpd (see paper)
56% identity, 93% coverage: 10:323/339 of query aligns to 14:326/326 of 5w3kA
- active site: K129 (= K126), D189 (= D186), E193 (= E190)
- binding cyclopropane-1,1-dicarboxylic acid: D189 (= D186), E193 (= E190), E229 (= E226), I249 (≠ V246), S250 (= S247), A253 (= A250)
- binding magnesium ion: V69 (= V66), K70 (≠ R67), A72 (= A69), N100 (≠ A97), D189 (= D186), E193 (= E190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y20), G25 (= G21), S26 (= S22), Q27 (= Q23), I46 (≠ L42), R47 (= R43), S51 (= S48), L78 (= L75), L79 (≠ T76), P80 (= P77), D81 (= D78), H106 (= H103), P131 (= P128), G132 (= G129), I249 (≠ V246), S250 (= S247)
Q02138 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
55% identity, 94% coverage: 10:326/339 of query aligns to 16:331/340 of Q02138
- V48 (≠ L42) mutation to L: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with P-49, L-52 and D-53.
- R49 (= R43) mutation to P: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, L-52 and D-53.
- K52 (≠ P47) mutation to L: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, P-49 and D-53.
- S53 (= S48) mutation to D: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, P-49 and L-52.
5e4rA Crystal structure of domain-duplicated synthetic class ii ketol-acid reductoisomerase 2ia_kari-dd (see paper)
55% identity, 92% coverage: 10:320/339 of query aligns to 14:324/466 of 5e4rA
- active site: K130 (= K126), D190 (= D186), E194 (= E190)
- binding oxo(propan-2-ylamino)acetic acid: P132 (= P128), D190 (= D186), E194 (= E190)
- binding magnesium ion: D190 (= D186), E194 (= E190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G21), S26 (= S22), Q27 (= Q23), S52 (= S48), L79 (= L75), V80 (≠ T76), P81 (= P77), D82 (= D78), V84 (= V80), A106 (= A102), H107 (= H103), P132 (= P128)
Sites not aligning to the query:
E0SRA9 Ketol-acid reductoisomerase (NAD(P)(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.383 from Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1) (see paper)
55% identity, 92% coverage: 10:320/339 of query aligns to 15:325/335 of E0SRA9
Query Sequence
>N515DRAFT_0568 FitnessBrowser__Dyella79:N515DRAFT_0568
MSSTTSNPTLANARIAVLGYGSQGRAHALNLRDSGLDVVVGLRKGGPSWERASAEGFTVA
EPGEAVRGADLVAVLTPDMVQPALYKESIEPNIKAGAALLFAHGFNVHFKQIAPREDIDV
ILVAPKGPGALVRREYEIGRGVPSIWAIHQDVTGQAEAKAKAYADGIGGGRALLIKTDFK
EETETDLFGEQAVLCGGASSLVQAGFETLVEAGYQPEIAYYEVLHELKLIVDLFYEGGIA
RMLEFVSETAQYGDYVSGPRVIDAGTKARMKDVLTDIQDGTFARNWIAEYQAGLPNYKRF
KQADLEHPIEQVGAKLRARMSWLQAGAAKAAGEPLKKVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory